(data stored in ACNUC9435 zone)

EMBL: AM039950.PE15

AM039950.PE15        Location/Qualifiers
FT   CDS_pept        11929..12324
FT                   /transl_table=11
FT                   /locus_tag="XCVc0015"
FT                   /product="putative TraA protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19784"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19784.1"
FT                   /translation="MSTAKSVSVWYTEDERIRVEQAAALAGYKHLSKYIRDKSLDRGSH
FT                   RESSRDSMEAWADRQELVGRLAEIERSQKGAHALLAMLLFLVRKKATTGEVNELVLACE
FT                   KSGVPADVLAASLPELAALLTRFTEDS"
     atgagtaccg caaaatctgt gtccgtttgg tacacggagg acgagcgcat ccgggtggaa        60
     caagcggccg ctctggccgg ctacaagcac ctgtcgaagt acatccgcga caagtctctc       120
     gaccgtggca gccatcgcga gtcgagccgc gacagcatgg aagcatgggc cgaccgacag       180
     gaacttgtcg gccgtttggc cgagatcgag cgcagccaga aaggcgcgca tgcgcttctg       240
     gcgatgctgc tttttctggt gcgcaagaag gcgaccacgg gcgaggtcaa cgagctggtt       300
     ctcgcatgcg agaaatccgg cgtgccggcc gacgtgctgg ccgcctccct gcccgagctg       360
     gccgcactgc taacccgctt tacggaggat tcgtaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page