(data stored in ACNUC9435 zone)

EMBL: AM039950.PE16

AM039950.PE16        Location/Qualifiers
FT   CDS_pept        12398..12691
FT                   /transl_table=11
FT                   /locus_tag="XCVc0016"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19785.1"
FT                   /translation="MSTKAVFTMKLEPELRDTFMAEAAADDRPAAQVVRELMRDYITRR
FT                   REAREYDEFVRRKVQVARKQRDAGLHFSNEEVEADAAARRVDLLRRAGEAGL"
     atgtcaacga aagccgtttt cacgatgaag ctggaaccgg agttgcgcga cacgttcatg        60
     gccgaagccg ccgcagatga ccgcccggcg gcgcaggtcg tgcgcgagct gatgcgcgac       120
     tacatcaccc gccgtcgcga ggcacgggaa tacgacgagt tcgtgcgtcg caaagtgcag       180
     gtcgctcgca agcagcgtga cgccggcctg cacttctcca atgaggaagt ggaagccgat       240
     gcagccgcgc gccgcgtgga cctgctacgc cgcgccggag aggctggatt gtga             294
//

If you have problems or comments...

PBIL Back to PBIL home page