(data stored in ACNUC9435 zone)

EMBL: AM039950.PE17

AM039950.PE17        Location/Qualifiers
FT   CDS_pept        12688..12981
FT                   /transl_table=11
FT                   /locus_tag="XCVc0017"
FT                   /product="putative plasmid stabilisation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19786"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19786.1"
FT                   /translation="MKVRWIAAARQDRADIIDYIAVETPRAALKMDDLFSEAAKRLGEF
FT                   PKLGCTGKIPGTRELIPHESYRLVYEVDEAADTVWVMTLIHTARQWPPARDD"
     gtgaaagtcc gctggatcgc ggccgcacgt caggaccgcg ccgatatcat cgattacatc        60
     gcggtagaga ccccccgcgc agcgctcaag atggatgatc ttttcagcga ggcagccaag       120
     cggctgggag agttccccaa gctcggctgc accgggaaaa ttcctggtac tcgcgagctt       180
     atcccgcatg aaagctaccg gctcgtctac gaagtggacg aagctgccga cacggtatgg       240
     gtgatgaccc ttatccacac agcgcgccag tggcccccgg cacgggacga ctaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page