(data stored in ACNUC9435 zone)

EMBL: AM039950.PE18

AM039950.PE18        Location/Qualifiers
FT   CDS_pept        13094..13714
FT                   /transl_table=11
FT                   /locus_tag="XCVc0018"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19787"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19787.1"
FT                   /translation="MKLFSAAVIAMSALFVTQAHAQQQPVNTGLGECVDFVIFASSTLT
FT                   GQVNGTTYPFVYGPATYLDKPGSTVYIQNYSCASNDIPGLYSRVSMVSHEMGHLYLDQG
FT                   WVLGTREDYIAKACTNEGRAVLNNSTARNEILDTSQGGADISLIAANAPALLSTIAAGG
FT                   ADLAQRVGDAFCEANVTSTTGENYKVYYGNEYDKLNPPSQEEQ"
     atgaagttgt tcagcgcggc cgtcatcgcc atgtcggcct tatttgtcac tcaggcccat        60
     gcacagcagc agcccgtgaa cacgggactt ggcgagtgcg tggacttcgt catctttgcc       120
     tccagcacgc tcaccggtca ggtcaacggc accacgtacc ccttcgtgta tggcccagcc       180
     acctatctgg acaagccggg cagcactgtc tacatccaga actattcgtg tgcctccaac       240
     gacatccctg ggttgtactc cagagtgtcc atggtcagcc acgagatggg ccacctatac       300
     ctggatcagg gctgggtgct cggcacacgg gaggactaca tcgccaaggc ctgcacaaat       360
     gaaggacggg ccgtgctcaa caactccacg gcgcgcaacg agatcctgga tacctcccag       420
     ggaggcgccg acatcagcct gatcgcggcg aacgctccgg cgctgctgtc cacgatcgcc       480
     gccgggggag ccgatctggc gcaacgtgtg ggtgatgcat tctgcgaggc taatgtcacg       540
     tccactaccg gtgagaacta caaggtgtac tacggcaacg agtacgacaa actcaatccc       600
     ccttcgcaag aggagcaata a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page