(data stored in ACNUC9435 zone)

EMBL: AM039950.PE19

AM039950.PE19        Location/Qualifiers
FT   CDS_pept        13718..14254
FT                   /transl_table=11
FT                   /locus_tag="XCVc0019"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19788"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19788.1"
FT                   /translation="MKTLAAALGALVLATAPLVLAAAVPRASAAAEKQLWAFSEKIALA
FT                   LPGNGKDVLTLVSPRPDSVAMTNGQKTRKPSKQIAPSLFASNAVVVMGADNRADSASFE
FT                   VTGSCVSMASLRKQYPSLIVMDYARGVNEHAVYTLGAQIGDAIVAYSFPASKLDCMSRV
FT                   FITPAKITKNKLGIE"
     atgaagactc tcgccgccgc ccttggcgcg ctcgtcctcg cgactgctcc gctcgtgctt        60
     gccgcagccg taccgcgcgc ctccgccgcc gctgaaaagc agctctgggc tttctcggaa       120
     aaaattgcat tggctcttcc agggaatgga aaagacgtac tgacgctcgt ctccccccgc       180
     cccgactcgg tcgccatgac caatgggcag aagactcgca agccgtcgaa gcaaatcgct       240
     ccgtcgctgt tcgcgtcgaa cgccgtggtg gtcatgggcg cggacaatcg cgcagattcg       300
     gcatccttcg aggtgacggg cagctgcgtc tcgatggcat cgctgcggaa acagtatccg       360
     agcctcatcg tgatggacta cgcgcgcggc gtcaatgagc atgccgtcta caccttgggc       420
     gcgcagatcg gcgatgcgat cgtcgcgtac tcgtttcctg ccagcaagct cgattgcatg       480
     agccgtgtgt tcatcacgcc cgcaaagatc acgaagaaca agctcggaat tgaatag          537
//

If you have problems or comments...

PBIL Back to PBIL home page