(data stored in ACNUC9435 zone)

EMBL: AM039950.PE2

AM039950.PE2         Location/Qualifiers
FT   CDS_pept        complement(2729..3049)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0002"
FT                   /product="putative PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19771"
FT                   /db_xref="GOA:Q3C0B3"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19771.1"
FT                   /translation="MQRGDLVTVSLQGDYGKPRPALVVQSDLLTDLESVVLCPVTSDLR
FT                   NAAFRVTVEPNPANGLRALSQVMVDKLSTLPRTKISEPFGRLDDERMKAIDRALLLVVG
FT                   VI"
     atgcagcggg gcgaccttgt gacggtttca ttgcagggcg actatggcaa accacggccc        60
     gccttggtcg ttcaatccga cttgctcacc gacctggaaa gcgtcgtgct gtgcccggtg       120
     acaagcgacc tgcgcaatgc cgcgttccgc gtcaccgtgg aaccgaaccc ggccaacggg       180
     ctgcgcgcgc tctcgcaggt catggtggac aagctctcaa cgctgcctcg caccaagatc       240
     agcgaaccgt ttggccgcct cgatgatgag cgtatgaaag cgatagacag ggcgctcctg       300
     ctggtcgttg gcgttatctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page