(data stored in ACNUC9435 zone)

EMBL: AM039950.PE21

AM039950.PE21        Location/Qualifiers
FT   CDS_pept        14527..16101
FT                   /transl_table=11
FT                   /locus_tag="XCVc0021"
FT                   /product="putative TraB protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19790"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19790.1"
FT                   /translation="MQKHEAEDATLFFGVSLPIAGWLAGTYAANVPLSPFPQALTAALH
FT                   ATPNNPFMVGGVVAGLGLAATTGYLFHEYGDDGFRGAPYRRWMRGSQMANWHSVKSKVN
FT                   AANRRENRRRRAEQRGAKDLPPIMIGPMPMPLHLENRNTLICASIGAGKSVALESMISS
FT                   AVKRRDKMAVIDPNGTFYSKFSFPGDTILNPFDRRSSGWTLFNEIKGVHDFDRMAKSVI
FT                   PPQIDPSDEQWCAYARDVLADTMRKLVETNNPDQDTLVNLLVREDGEVIRAFLANTDSQ
FT                   GYFRENAEKAIASIQFMMNKYVRPLRFMTKGDFSLHKWVHDPNAGNLFITWREDMRAAQ
FT                   RPLVATWIDTICATILSISDDAQHLSRRLWLFLDELESLGKLESFVPAATKGRKHGLRM
FT                   AASIQDWAQLDETYGKDAAKTLLGCFRNYLIFGASNALNADKASEILGKQHVERIQMTT
FT                   NAGGSGGGGRSRHVVASPPEPVVLDSEISNLKDLEGYVMFAEDFPIAKIKLPYVKYPHR
FT                   AAAIDIK"
     atgcagaagc acgaagccga ggatgccacg ctgttctttg gcgttagttt gccgattgct        60
     ggctggctcg ccggcacgta tgcagcgaat gtgccgctgt caccgttccc gcaagcgctc       120
     accgctgcgc tacacgcgac gccgaacaat ccgttcatgg ttggcggggt tgtggccggg       180
     ttgggactgg ccgcgaccac cgggtatctg ttccacgagt acggcgacga tgggttccgg       240
     ggcgcaccgt atcgccgctg gatgcgcggc tcgcagatgg cgaactggca cagcgtaaag       300
     agcaaggtca acgcggccaa tcgccgggag aatcgccggc gacgggccga acagaggggc       360
     gcgaaggatt tgccccccat catgatcggc cccatgccga tgccgctgca ccttgagaac       420
     cgtaacacgc tgatttgcgc gtccatcggc gcgggcaaat cggttgcgtt ggaaagcatg       480
     atctcgtcgg ccgtgaaacg gcgcgacaag atggccgtga tcgacccgaa cgggacgttc       540
     tattcgaaat tcagctttcc cggcgacacg attctcaacc cgtttgaccg tcgctcgtcg       600
     ggctggacgc tgttcaacga gatcaagggc gtgcatgact tcgaccggat ggcgaaaagt       660
     gtcatcccgc cgcagatcga tccaagcgat gaacagtggt gcgcctatgc gcgtgacgtg       720
     ctggccgaca ccatgcgcaa gctggtcgag acgaacaacc cggatcaaga cacgctggtc       780
     aacctgctgg tgcgcgagga tggtgaagtc atccgcgcgt ttctcgccaa caccgattcg       840
     cagggctact tccgcgagaa cgccgagaag gccatcgcgt cgatccagtt catgatgaac       900
     aagtacgtgc ggccgctgcg cttcatgacc aagggcgatt tctcgctgca taagtgggtg       960
     catgacccca acgccggcaa tctgttcatc acgtggcgcg aggacatgcg ggccgcgcag      1020
     cgcccgcttg tggcgacatg gatcgacacg atttgcgcga cgattctcag tatctccgac      1080
     gacgcgcaac acctctcccg gcgtctgtgg ctgttcctcg atgagctgga atcgctcggc      1140
     aagctcgaat cgttcgtgcc ggccgccacg aagggccgta agcacgggct gcgcatggcg      1200
     gcctcgatac aggattgggc gcagctcgat gagacctacg gcaaggatgc ggccaagacc      1260
     ttgctaggct gcttccgtaa ttacctcatc tttggcgcgt cgaacgcgct caatgccgac      1320
     aaggcgagcg agattcttgg caagcagcac gtcgagcgca tccagatgac gaccaacgca      1380
     gggggaagcg gtggaggcgg ccgcagccgc catgttgtcg ccagtccacc ggagccggtg      1440
     gtattggact cggaaatctc aaacctcaag gacctggagg gctacgtcat gtttgccgag      1500
     gacttcccca tcgcgaagat caagctgccc tacgtgaagt atccgcatcg cgcggccgcc      1560
     atcgacatca agtga                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page