(data stored in ACNUC9435 zone)

EMBL: AM039950.PE22

AM039950.PE22        Location/Qualifiers
FT   CDS_pept        16115..19090
FT                   /transl_table=11
FT                   /locus_tag="XCVc0022"
FT                   /product="putative TraI protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19791"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19791.1"
FT                   /translation="MLNVTPIRGNNQYAAAHYFSAADDYYAKEHPGEWQGQGAQALGLT
FT                   GPVEQAQLSRLLDGQLPNGERIQTTFDPTDNKKRMGLDLTFSAPKSVSMQALVAGDKDV
FT                   TAAHDRAVTRALEQVERLAEARKKVKGKSYRERTANMVIGKFRHEMSRAKDPQLHTHAV
FT                   VLNMTQRADGAWRALSNEDIFRVQHEVDALYKAELARGLQALGYAIRLVDDQGNFELDH
FT                   ISRDQIEAFSARSRVIEEALANEGKTRATATTLEKQIISLATRPRKDESDRELVKQYWV
FT                   EKSRELGIDYGLRSQLDGRTYEAGDSFGTRGRERGDAGDRIAATSLPASLTPAQAVVQY
FT                   AINHLTEREAVVRETALTATALRRAVGLAGPDEVRAEIKRLAGQGALIEAVPAYRMADR
FT                   KDGPALSSAGWKSYLQELKGWSDKQAQQYVGNAIKQGSLVPAEKRYTTQKALAREKAIL
FT                   AIERTGRGAIEPIMTAAAVKTALEGTALSAGQRSAVETIVSTKNRFVGIQGDAGTGKTY
FT                   TVNQAVALIKQASAVSEGYRTVALAPYGNQVKALKNEGLEAHTLASFLRTKDKPIDGKT
FT                   IIVLDESGVVGARQMEQVMRVVEKAGARMVLLGDTKQTEAIEAGKPFAQLQQDGMQTAR
FT                   ISEIQRQKDHELKTAVEHAAEGRVTPSLAHIKHVEELKEPIERHRAIVNDYIQLTEPER
FT                   RETLIVAGTNEARREINRMVRQSLDLTGKGREFETLTRVDMTQAQRRFAPSYQPGMVIQ
FT                   PEKDDQKAGLTRGETYRVKDALPGNALVLQRQDGTTTTINPRKATQLSVYRLERAELSV
FT                   GDTVRINRNDPGRDLTNGDRMRVAGVIGGVVKLESVEQRDGRPARALELPTNRPLHLEH
FT                   AYASTVHSAQGLTNDRALIALDTNSRTTSMNLYYVAISRACHEARVYTNSVKELPAAIA
FT                   RRFDKTTALAIQRERQLQRRDAGMQPKGAADGKQALQRQQFQQQRKQPASGKKPSEYGR
FT                   FG"
     atgctcaatg tgacgccgat tcgcggcaac aaccagtacg cggccgcgca ttacttctcg        60
     gcggccgacg actactacgc caaggagcac cccggcgagt ggcaaggcca aggcgcacag       120
     gcgcttggcc tgacggggcc ggtggaacag gcgcagctct cgcggctgct ggacggccaa       180
     ctcccgaacg gcgagcgcat ccagacgacc tttgacccga ccgacaacaa gaagcgcatg       240
     gggctggacc tgacgttttc cgccccgaag tcggtttcca tgcaggcgct tgttgctggc       300
     gacaaggacg tcaccgctgc gcacgaccgc gccgtgacgc gcgcactgga gcaggtcgag       360
     cggctggccg aggcccggaa gaaggtcaag ggaaagagct accgcgagcg caccgcaaac       420
     atggtcatcg gcaagtttcg gcacgagatg agccgggcca aagacccgca gctacacacg       480
     catgcggtcg tgctcaacat gacgcagcgc gcagacggcg cttggcgcgc cctgtcgaac       540
     gaggacatat tccgcgtgca gcacgaggta gacgcgctct acaaggccga gctggcgagg       600
     ggcttgcaag cgcttggcta cgcgatacgc ctggtcgatg accagggcaa tttcgagctg       660
     gaccacatca gccgcgacca gatcgaggcg ttttcggcgc gtagtcgcgt catcgaggaa       720
     gcgcttgcca acgagggcaa gacgcgagcg acggcgacaa cgcttgaaaa gcagatcatt       780
     tcgcttgcca cgcggccgcg caaagacgag tccgaccgcg agctggtcaa gcagtattgg       840
     gtcgaaaaaa gccgcgagct tgggatcgac tacggcctgc gctcgcagct cgatggccgc       900
     acctacgagg caggcgacag cttcggcacc cgtggccgtg agcggggcga cgccggcgac       960
     cgcatcgcag ccacgagcct gccggcgagc ctcacgccgg cacaagccgt cgtgcagtac      1020
     gccatcaacc acctgaccga gcgtgaggct gttgttcgcg aaaccgcgct cacggccacg      1080
     gcgttgcgtc gcgcggtcgg gctggcagga ccggacgagg ttcgcgccga aatcaagcgg      1140
     ctcgccggcc aaggcgcgtt gatcgaagcc gtgccggcgt atcgcatggc cgaccgcaag      1200
     gacgggccgg cgctctcgtc ggccggctgg aaaagctatc tgcaagagct gaaaggctgg      1260
     tccgacaaac aggcgcagca gtacgtcggc aacgcgatca agcagggttc gctcgtgccg      1320
     gccgagaagc gttacacgac acagaaggcg ctcgcccgcg agaaagcgat tctcgccatc      1380
     gagcgcaccg ggcgcggagc tatcgagccg atcatgacgg cggccgccgt caaaacggcg      1440
     ttggaaggca ccgcgttgag cgccggccag cgttcggccg tggaaaccat cgtcagcacc      1500
     aagaatcggt tcgtcggcat ccagggcgac gccggcaccg ggaaaaccta taccgtgaat      1560
     caggcggtcg cgctcatcaa gcaggcgtcg gccgtgagcg agggctaccg caccgttgcg      1620
     ctcgcgccct acggcaatca ggtcaaggcg ctcaagaacg aagggctgga agcgcacacg      1680
     ctggccagct ttctgcgcac caaggacaag cccatcgacg gcaagacgat catcgttctg      1740
     gacgaatcgg gcgtcgtcgg cgctcgccag atggaacagg tcatgcgggt tgtcgagaaa      1800
     gccggcgctc gcatggtctt gcttggcgac accaagcaga ccgaggccat cgaggccggc      1860
     aagccgttcg cgcagctcca gcaggacggc atgcagaccg cgcgaatcag cgagattcag      1920
     cgccagaaag accacgagct gaaaaccgct gtcgagcacg cggccgaggg ccgtgtcacg      1980
     ccatcgcttg cgcacatcaa gcacgttgag gagctgaaag agccgatcga gcggcaccgg      2040
     gccatcgtga acgactacat ccagctcacc gaacccgagc gccgcgaaac gctgatcgtt      2100
     gcgggcacca atgaagcccg ccgcgagatc aaccgcatgg tgcgccagtc gctggacctg      2160
     accggcaagg gtcgggagtt cgagacgttg acccgcgtgg acatgacgca ggcacagcgc      2220
     cgctttgcgc cgagctatca gccgggcatg gtgatccagc ccgagaagga cgaccagaaa      2280
     gccggcctga cgcgaggcga gacctaccgc gtcaaggacg cattgcccgg caatgcgctg      2340
     gtcttgcagc ggcaggacgg caccaccacc acgatcaacc cgcgcaaggc gacgcagctc      2400
     agcgtctacc gccttgagcg cgccgagctg tcggtcgggg ataccgtgcg gatcaaccgc      2460
     aacgatcccg gccgcgacct cacgaacggc gaccgcatgc gcgtggccgg cgtgatcggc      2520
     ggcgtcgtca agctcgaatc ggtcgagcag cgcgacggcc gaccggcacg cgcgcttgag      2580
     ctgccgacga atcgaccgct ccaccttgag cacgcctatg cgtccaccgt ccacagcgcg      2640
     cagggcttga ccaacgaccg cgccctcatc gcgctcgata ccaacagccg caccacgtcg      2700
     atgaatttgt attacgttgc catcagccgg gcctgccacg aggcgcgcgt ctacacgaac      2760
     tcggtcaagg agctgccggc cgccatcgcg cggcgcttcg acaagacgac ggccctagcg      2820
     atccagcgcg aacgccaatt gcagcgccgc gacgccggta tgcaacccaa aggcgcagcc      2880
     gacggcaagc aggcgttgca gcgtcagcag ttccaacagc agcgcaagca gccggcgagc      2940
     ggaaagaaac cgtccgagta cggacgcttt ggctag                                2976
//

If you have problems or comments...

PBIL Back to PBIL home page