(data stored in ACNUC9435 zone)

EMBL: AM039950.PE23

AM039950.PE23        Location/Qualifiers
FT   CDS_pept        complement(19160..19486)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0023"
FT                   /product="putative PemK-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19792"
FT                   /db_xref="GOA:Q3C0E0"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0E0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19792.1"
FT                   /translation="MMRGDFVTIAMQGDFGKPRPALVIQANQFDEHTTVTVLPVTSTLV
FT                   AAPLLRITVHPSTDNGLLKPSQVMVDKAMTVKRDKIGRAFGRVDADALVEIERCLAVFL
FT                   GIAK"
     atgatgcgag gtgactttgt gaccatcgcc atgcaaggcg acttcggaaa accacggccc        60
     gctctggtca tccaggccaa ccagtttgac gaacacacca ccgtgacggt gctgccggtg       120
     acaagcacgc ttgttgctgc gccgctgctg cgcattaccg ttcatccaag taccgacaat       180
     ggcctgctga agccgtctca ggtgatggtg gacaaggcca tgaccgtgaa gcgtgacaag       240
     ataggtcggg cctttgggcg cgtagacgct gatgcgttgg tggaaattga gcgctgcctg       300
     gccgtgttct tgggcatcgc taagtga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page