(data stored in ACNUC9435 zone)

EMBL: AM039950.PE25

AM039950.PE25        Location/Qualifiers
FT   CDS_pept        complement(19838..20434)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0025"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19794"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19794.1"
FT                   /translation="MPTSNGRYCRASDGRGQESRAGHGDHLPMGRSSRTPEHLAAIVKA
FT                   LWLRHGPRNLDDVGVMQQSIQQGGLMKVTTILLDTAGEIAHRMAISMNALMLTVAAEAR
FT                   QDMAREHGADWAAGAVTFFGTEILKAFQSNKPDRDREMERSMMSLAMAVWVCDSVYGGL
FT                   AAETFVASDLRFTITHDGIVRYDRLPKPDDRADHQ"
     atgccaacga gcaatggcag atattgtcgt gcgagcgatg gacgcggcca agaaagcaga        60
     gcgggacatg gcgaccattt accaatgggt cgcagcagcc gaacgcccga gcacctcgca       120
     gcaatagtca aggctctttg gctccgacac ggccctcgga atctagatga cgtcggcgtg       180
     atgcaacaat ccatccagca aggcggcctc atgaaagtca caaccatcct actcgacacc       240
     gccggcgaga tcgcccaccg catggcgatc tcgatgaatg cattgatgct caccgtcgcc       300
     gccgaggctc ggcaggacat ggcacgggag cacggcgcgg actgggcagc cggtgccgtg       360
     acgttcttcg gcacggagat cctcaaagcg ttccagtcga acaagccgga tcgcgaccgt       420
     gagatggaac gctccatgat gagcttggcc atggcggtat gggtctgcga ttccgtctat       480
     ggcggccttg ctgctgagac atttgtcgct tccgatctgc gtttcaccat tacgcacgac       540
     ggcatcgtgc gctatgaccg gctcccaaag cccgacgatc gagctgacca ccagtag          597
//

If you have problems or comments...

PBIL Back to PBIL home page