(data stored in ACNUC9435 zone)

EMBL: AM039950.PE27

AM039950.PE27        Location/Qualifiers
FT   CDS_pept        complement(21350..21937)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0027"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19796"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19796.1"
FT                   /translation="MKKLIVALFIGAAAVSAHASEYGCKVLLCLANPASNGGPKGVSEC
FT                   VPPIDQLYHDLSKGRPFPTCDLADGNDGSSYARQVYDPYDPCPAPLQPAARGSYVVQGQ
FT                   KKTGTNKPGWWGGDGSYTLSGQPQVSQSQSDYGHSSGARACVGKSVGSYTVGSYDSSDT
FT                   VDVFDKVIWQPAQNPRAIDVFIDNTWQQRVRW"
     atgaagaaac tgatagtcgc gctgtttatc ggtgctgctg ctgtgtccgc gcacgcctcc        60
     gaatatgggt gcaaggtgct gctgtgcctt gccaatcccg cgtccaatgg cggcccgaag       120
     ggcgtgtccg aatgcgttcc ccccatcgat cagctctacc acgatctcag caaggggcgg       180
     ccgttcccga cgtgcgatct cgcggacggc aatgatggtt cgagctacgc ccggcaggtc       240
     tatgacccgt atgacccttg cccggccccg ttgcaacctg ccgcacgcgg ttcctatgtc       300
     gtgcaggggc agaagaaaac gggcaccaac aagccgggat ggtggggcgg cgacggctcg       360
     tacacgctga gcggacagcc gcaagtgtct cagtcgcaaa gcgactacgg ccatagctcg       420
     ggtgcgcggg cctgcgtcgg gaagtcggtc ggctcataca ccgtaggcag ctacgacagc       480
     agcgacaccg tggacgtttt cgacaaggtg atctggcagc cggcgcagaa tccgcgagcc       540
     atcgacgtgt tcatcgacaa cacgtggcag cagcgcgtgc gctggtag                    588
//

If you have problems or comments...

PBIL Back to PBIL home page