(data stored in ACNUC9435 zone)

EMBL: AM039950.PE34

AM039950.PE34        Location/Qualifiers
FT   CDS_pept        complement(27468..27875)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0034"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19803"
FT                   /db_xref="GOA:Q3C0C9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19803.1"
FT                   /translation="MPKALWTWILMGTAVVLIGGYGLLKIMSREPIIPMPVPQQGMPTP
FT                   SPSVETQNGGNPLLTADKVAVARWFPGHCFAELYNKDPSFGGRLIPSCVVKVIQQVKAD
FT                   TGVTLTEADIKSPDVLAHFKHVYGDDNQWRH"
     atgcctaagg ccctctggac atggattttg atgggcacgg ccgttgtgct catcggtggt        60
     tacggcctgc ttaagatcat gagtcgcgag ccgatcatac cgatgccagt accgcagcaa       120
     ggaatgccga cgccatcacc ttccgtcgag acgcagaacg gtgggaatcc ccttctgact       180
     gcggacaagg tggccgttgc gcgctggttc cccggccact gctttgccga gctgtacaac       240
     aaagatccat cgttcggcgg gcggttaatt ccgagctgcg ttgtcaaagt gattcaacag       300
     gtcaaggccg ataccggcgt cacgcttaca gaggcggaca ttaaatcacc cgacgtgttg       360
     gcgcatttca agcacgttta tggggatgac aaccaatggc gacactga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page