(data stored in ACNUC9435 zone)

EMBL: AM039950.PE39

AM039950.PE39        Location/Qualifiers
FT   CDS_pept        complement(32883..33122)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19808"
FT                   /db_xref="GOA:Q3C0C4"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR031914"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19808.1"
FT                   /translation="MNTVRWNIAVSPDVDQSVRMFIAAQGGGRKGDLSRFIEDAVRAYL
FT                   FERAVEQAKAATVGMGETELNDLIDEAVQWAREH"
     atgaataccg tgcgctggaa catcgccgta tcgccggacg tggatcagtc cgtccgcatg        60
     ttcatcgccg cgcaaggcgg cggtcgcaag ggcgacctgt cacgcttcat cgaggatgcg       120
     gtgcgcgcct acctcttcga gcgggctgtg gaacaagcca aagccgctac ggtgggtatg       180
     ggtgagacag aactgaacga cctcattgat gaggcggtgc aatgggcgcg tgagcattaa       240
//

If you have problems or comments...

PBIL Back to PBIL home page