(data stored in ACNUC9435 zone)

EMBL: AM039950.PE4

AM039950.PE4         Location/Qualifiers
FT   CDS_pept        complement(3510..3836)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19773"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19773.1"
FT                   /translation="MSMKGKPNTAQFKPPKDPTAFLEGGEADKAEKPLVAPAAVATPPA
FT                   ATPPAAEEAQRYGRARVQKIFNFPEELADRLRREALKRSEEKGVRVTEKDIVIEALEAF
FT                   LNGI"
     atgagtatga agggcaagcc caacacggcc cagttcaagc cgcccaaaga cccgaccgcc        60
     ttcctcgaag gcggggaggc cgacaaggca gaaaagccgc tggtagcccc tgcggccgtg       120
     gccacgccac cggccgccac accgcccgct gccgaggaag cgcagcgcta cggccgcgct       180
     cgggtgcaaa aaatcttcaa cttccccgag gagctggctg atcgcctgcg ccgcgaagca       240
     ctcaagcgct ccgaagagaa gggcgtccgc gtcacggaga aggacatcgt gatcgaggcg       300
     ctggaagcct tcctcaacgg gatatag                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page