(data stored in ACNUC9435 zone)

EMBL: AM039950.PE40

AM039950.PE40        Location/Qualifiers
FT   CDS_pept        33337..34260
FT                   /transl_table=11
FT                   /locus_tag="XCVc0040"
FT                   /product="Site-specific recombinase / resolvase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19809"
FT                   /db_xref="GOA:Q3C0C3"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19809.1"
FT                   /translation="MKIGYARVSTREQNPALQVDSLKAAGCERIYQDVASGAKTARPAL
FT                   DELLGQLRGGDVLVIWKLDRMGRSLKHLVELVGSLMERKVGLLSLNDPIDTTSAQGRFV
FT                   FNLFATLAEFERELIRERTQAGLTAARARGRVGGRPKGLSPQAEATALAAETLYRERKL
FT                   SVAAIAQKLHLSKSTLYSYLRHRGVEIGPYKQSAQSPINVSVVESGNADQPKVATILLT
FT                   LRIENNSKFVRGKKRSIEHVEFFDLAQYDATRRPNGEYELKVPYDTDEELDEAVNDLLT
FT                   DIACGADDRHCFSESHARMEGTDRHW"
     atgaaaatcg gctatgcgcg cgtatccacg cgcgaacaga acccagcctt gcaggtggac        60
     tccctcaagg cggccggctg cgagcgcatt tatcaggacg ttgcgagcgg cgcgaagacc       120
     gcgcgcccag cgctcgatga actgctgggc cagttgcgtg gcggcgacgt gctggtgatc       180
     tggaaactcg accgcatggg acgctcactc aagcacctgg ttgagttggt gggtagcctg       240
     atggaacgca aggtcgggct gctcagcctg aatgacccca tcgacaccac cagcgcccaa       300
     gggcggttcg tgttcaacct gttcgccacg ctggccgagt tcgagcgcga gctaattcgc       360
     gagcgcaccc aggccgggct gacggccgcg cgggcgcgtg gcagggtcgg tgggcgaccc       420
     aagggcctgt cgccgcaggc cgaagcgaca gcgctggcgg ccgagaccct ataccgcgag       480
     cgcaagctgt cggtcgctgc cattgcgcag aaactgcact tgtccaagag cacgctgtac       540
     agctacctgc ggcatcgcgg cgtagagatc ggcccgtaca aacaatcggc gcagtcgccg       600
     ataaacgtct ccgtggtcga gagcggaaac gctgaccagc cgaaggtcgc caccatcctg       660
     ctgaccttgc gcatcgagaa caatagcaag ttcgtgcgcg gaaagaagcg ctcgatcgag       720
     catgtcgagt tttttgatct tgcccaatac gatgccacgc ggcggccgaa cggggaatat       780
     gaactgaagg tgccctatga cacggatgaa gagctggatg aagccgtgaa cgatttgcta       840
     accgacatcg cctgcggtgc ggatgaccgc cactgtttct cagagagcca cgcccgcatg       900
     gaaggtacag accggcactg gtga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page