(data stored in ACNUC9435 zone)

EMBL: AM039950.PE43

AM039950.PE43        Location/Qualifiers
FT   CDS_pept        complement(37738..37995)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0043"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19812"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19812.1"
FT                   /translation="MLTLTKKELAVLDEAQPDYAVYLVEAEHESSRWWRMTVKLPTHNK
FT                   AYEVVTALGKTKLWKRLDIAVDFIKESCPHTKTVFVVFAP"
     atgctcaccc tgaccaagaa agagctggcg gtgctcgatg aggctcaacc ggactatgcg        60
     gtttatctgg ttgaggcgga gcacgagagc agccggtggt ggcggatgac ggtgaagtta       120
     cccacgcaca acaaagctta tgaggtcgtt accgcgcttg gtaaaaccaa gctctggaaa       180
     cgcttggaca tagctgtgga tttcatcaag gagagctgcc cgcacacaaa gaccgtgttc       240
     gtagtttttg ccccgtag                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page