(data stored in ACNUC9435 zone)

EMBL: AM039950.PE5

AM039950.PE5         Location/Qualifiers
FT   CDS_pept        complement(3833..4459)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0005"
FT                   /product="putative partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19774"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0B0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19774.1"
FT                   /translation="MVFACVNTKGGVGKTTTAVHLAVMLARQGKTLLIDGDPQASAASW
FT                   AAWRRETQYDPSPTTTCLAGKAILSEGKQLATGFEHVVVDAGGRDSVGLRSALLLAQRA
FT                   VIPVGASNLDAAAMTDLLEVVELARDYNPELDVRVLLTRIDPRTKDAAEMLEFLAEQKL
FT                   TVLPTKVCERVAFRRAIGEGATVQELGRDQAAIAEMEAFFKEVMQ"
     atggtcttcg cgtgtgtcaa caccaagggc ggcgtcggca agaccacgac cgccgtgcat        60
     ctggcagtga tgctcgcccg tcagggcaag acgctgctga tcgacggcga cccgcaggcc       120
     tcggccgcga gctgggcagc atggcgtcgt gagacgcagt acgacccgtc acccaccacc       180
     acctgcctcg ctggcaaggc gatcctcagc gaaggcaagc aactggccac cggctttgag       240
     catgtcgtcg ttgatgcggg tggccgtgat tctgtgggcc tgcgctccgc gctgctgttg       300
     gcccagcgtg ccgtgatccc ggtcggtgca tccaatctgg acgcagcggc catgaccgac       360
     ttgctcgaag ttgtcgagct ggcccgcgac tataaccctg agctggacgt gcgcgtgctc       420
     ctgacccgca tcgatccgcg caccaaggat gcggccgaga tgttggaatt cctagccgag       480
     cagaagctga ctgtattacc tacaaaagtc tgcgagcggg tggcctttcg ccgtgccatc       540
     ggtgagggtg cgaccgttca ggagctaggc cgcgatcaag ccgccattgc cgagatggaa       600
     gccttcttca aggaggtgat gcaatga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page