(data stored in ACNUC9435 zone)

EMBL: AM039950.PE6

AM039950.PE6         Location/Qualifiers
FT   CDS_pept        complement(4663..4956)
FT                   /transl_table=11
FT                   /locus_tag="XCVc0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19775"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19775.1"
FT                   /translation="MRLGTGPCATPTGLFGNNNTTILITKQLIAARFRLAVGAVRRNPV
FT                   GGGGRRRAGTVRSRQKTAPTAWRHILLNGHYTFQRSGKIIDLDALVAGLELG"
     gtgcgtcttg ggacgggtcc atgtgcaact ccgacgggtt tgtttggtaa taataataca        60
     actattctta ttaccaaaca actgattgca gcccgtttcc gactggcggt cggcgcggtg       120
     cggcggaatc cggtgggggg tgggggtcgg cggagggctg gcacagtgcg cagcaggcaa       180
     aaaacggcgc cgacggcatg gcggcacatc ctgctgaacg ggcactacac cttccagagg       240
     agcggcaaga tcatcgacct ggatgcgctc gtggccggac tggagctggg atga             294
//

If you have problems or comments...

PBIL Back to PBIL home page