(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB1

AM039950.VIRB1       Location/Qualifiers
FT   CDS_pept        complement(21983..22894)
FT                   /transl_table=11
FT                   /gene="virB1"
FT                   /locus_tag="XCVc0028"
FT                   /product="type IV secretion system protein VirB1"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19797"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19797.1"
FT                   /translation="MQVRDVITMAAGLLAVVPLFAGAQTPAQPLPFEKLAAECAPDVHP
FT                   STLKGVVSTESSWNPYAIGVVGGRLDHQPRGLAEAVATARELDRQGFNFSMGLGQVNRY
FT                   NLAKYGESYETVFEPCRNLKAGSAILKDCFQRAKAQMGDDQHALRAAFSCYYSGNFTRG
FT                   FRADKAGQPSYVQKVVANATGAAQPIPVVPAVKPESSDGAVAVRPAGRAAGPAKQAATS
FT                   SQWVIFAEGSPQGGQSVVPTDAASAKEPAVKVQLVTPGAAPAVAAAPAERVQTQRQAQA
FT                   VPVQRATANSTQQDAPFVQFVH"
     atgcaggtgc gtgacgtgat aacgatggcg gccgggctgt tggccgttgt gccgctgttc        60
     gctggtgcgc aaacgccggc acagccgctg ccgtttgaga agttggccgc cgagtgcgcc       120
     ccggacgttc acccgagcac gctcaagggt gtggtgagca ccgaatcgtc gtggaatccc       180
     tacgcgatcg gcgtggtggg cggccgcctc gatcatcagc cgcgtggcct ggctgaagcg       240
     gttgccacgg cgcgcgagct ggatcggcag ggcttcaatt tctcgatggg cttgggacag       300
     gtcaaccggt acaacctcgc caagtacggc gagagctacg agaccgtgtt cgagccgtgc       360
     cgcaatctca aggcgggcag cgcgatcctc aaagactgct tccagcgcgc caaggcgcag       420
     atgggtgacg atcagcacgc cttgcgggcc gcgttcagtt gctactactc gggcaacttc       480
     acgcgcggtt ttcgagcgga caaagccggc cagccgagct atgtgcagaa ggtcgtagcg       540
     aacgcgacgg gggcggctca gccgatcccc gttgtgccgg ccgtgaagcc cgaaagctcc       600
     gatggtgccg tggccgttcg ccctgctggc cgcgcggcag ggccggcgaa acaggcggcg       660
     acgtcgagcc aatgggtgat cttcgcggag ggatcgccgc agggcggcca gtcggtcgta       720
     cccacggatg cggcgtcggc caaggagccg gctgtcaagg tccagctcgt aacgccgggc       780
     gctgcgccgg ctgttgccgc agcgcctgcc gagcgagtgc agacgcagcg ccaagcacaa       840
     gccgtcccgg tgcaacgggc aacggcaaac agcactcagc aggacgcgcc cttcgtgcag       900
     ttcgtgcatt ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page