(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB10

AM039950.VIRB10      Location/Qualifiers
FT   CDS_pept        complement(23914..25134)
FT                   /transl_table=11
FT                   /gene="virB10"
FT                   /locus_tag="XCVc0030"
FT                   /product="type IV secretion system protein VirB10"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19799"
FT                   /db_xref="GOA:Q3C0D3"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19799.1"
FT                   /translation="MSDQTNKPQDDREAAVQAWEKQANASLVADDRKKKMSGIAIAAIA
FT                   AAALGAVWYMKHDGSEPAKPAGNSELSIPERKPVPKLKDQEPASVPAVTSAPAATPASA
FT                   AQADDPMKAQREQMEMQRREQERRILEARMKSAIIPPNSNNQAAASAQPVGDSGDQGPS
FT                   NAGALGGGSGERGAQDPNSRFARAVSGNGVAVSKANQIDNLPYKVLQGKLIEAVLEPRA
FT                   ISDLPGMVCATVQRDVYGEQDRNKLIPWGSRVCGVYSAEVRKGQDRLFVIWNTVRRPDG
FT                   VQVALDSAGADQLGTAGMGGIVDTHFAEIFGMSALLSIIGAGASNAGVSSGDQYNSTAA
FT                   YRQSVQQAAAQTSQSVLQPYINIPPTITVPAGSRVRIYVNKDLDFTPIYKDDIDAAKHG
FT                   DGVTFIP"
     atgagcgatc agaccaacaa gccgcaggat gaccgcgagg cggcggtcca agcgtgggaa        60
     aagcaggcaa atgcctcgtt ggtggccgat gatcgcaaga agaagatgag cggtatcgcg       120
     attgctgcca tcgcggcggc agccctcggt gctgtctggt acatgaagca cgacggtagc       180
     gagccggcga agccggcggg caacagcgaa ctgagcattc ccgagcgtaa gccggtgccc       240
     aagctcaagg accaggaacc ggccagcgtg ccggctgtga cttccgcgcc ggccgcaacg       300
     cctgcgagcg cggcgcaagc cgatgacccg atgaaggccc aacgcgaaca gatggaaatg       360
     cagcggcggg aacaagagcg gcggatactc gaagcccgca tgaagtcggc catcatcccg       420
     ccgaactcaa acaaccaggc ggcagcgtct gcgcagccgg tgggcgatag cggcgaccaa       480
     gggccatcga atgccggcgc gctcggcggc ggtagcggcg agcgtggcgc acaagacccg       540
     aattcgcgtt ttgcgcgggc cgtgtctggc aatggcgtgg cggtcagcaa ggcaaatcaa       600
     atcgacaacc tgccctacaa ggtcttgcag ggcaagctca tcgaggccgt gcttgaaccg       660
     cgggcgatct ccgatctgcc cggcatggtg tgcgcgaccg tgcagcgcga cgtgtacggc       720
     gagcaagacc ggaacaagct gattccgtgg ggttcgcggg tgtgcggcgt gtacagcgcc       780
     gaagtgcgca aggggcaaga ccggctgttc gtgatctgga acacggtgcg ccggccggat       840
     ggcgtgcaag tggcgctgga tagcgcgggc gcggaccagc tcggcacggc cggcatgggc       900
     ggcatcgtgg acacgcattt tgccgagatt ttcggcatgt ccgcgctgct gtcgatcatc       960
     ggtgccggcg cgtcgaacgc cggcgtgagt tcgggcgatc agtacaactc gaccgccgcc      1020
     tatcggcaat cggtgcaaca ggcagccgcg caaacctcgc agtcggtgct acagccgtac      1080
     atcaatatcc cgccgaccat caccgtgccg gccggctcgc gcgttcgcat ctacgtgaac      1140
     aaagacctcg atttcacacc gatctacaag gatgacatcg acgcagccaa gcacggcgac      1200
     ggcgtgacgt tcatcccgtg a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page