(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB11

AM039950.VIRB11      Location/Qualifiers
FT   CDS_pept        complement(22881..23903)
FT                   /transl_table=11
FT                   /gene="virB11"
FT                   /locus_tag="XCVc0029"
FT                   /product="type IV secretion system protein VirB11"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19798"
FT                   /db_xref="GOA:Q3C0D4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19798.1"
FT                   /translation="MSQIASFRTKLSLLADHLDDKQVTEIQVNKPGELWLRKKDAYYAE
FT                   QIEVPGLTYQLLSSLAEVTASFKSLDVDRESPILSAEIPVNLDDGVPDFERGTYRTEMI
FT                   LPPVVPEGTIAMTIRKQSLVRMSLPKYKEQGAFRFVNSDVTDEPYSDARLLELYRAKEW
FT                   DQFLRGAVLAHKNIVISAGTYCGKTTCLNALVQEIPAHERIVTIEDSREIEPAQPNCVR
FT                   LSYARHQASGQAAVTPTTLLRSCMRLTPDRVIMGEIRGPEAVEFLNMLNTGHKGSLTTI
FT                   HTDSPAEMYDRFGELMDGHTSMTREQVIARVKRRIDVVVQWKYTERNGRYISEIIYAGA
FT                   "
     atgtcgcaga ttgcctcctt ccgtaccaag ctctccttgc tggccgacca tctcgatgac        60
     aagcaggtca ccgagattca ggtcaacaag ccgggagagc tgtggctgcg aaagaaagac       120
     gcgtactacg ccgagcaaat tgaagtgccg gggctgacat accagttgct ttcgtcactg       180
     gccgaggtca cggcgtcttt caagagtctg gacgttgatc gggagagtcc gatcctctcg       240
     gcggagattc cggtgaatct cgatgacggc gttccagact tcgagcgcgg aacgtaccgc       300
     actgaaatga tccttccgcc tgtcgtaccg gagggcacca tcgcgatgac gattcgtaag       360
     caatcgctgg ttcgcatgag cctgccgaaa tacaaggagc agggcgcttt ccgattcgtc       420
     aatagcgacg tgaccgatga gccgtattcc gatgctcgct tgctggagct gtatcgcgcg       480
     aaagagtggg accagttcct gcgcggggca gtgttggccc acaagaacat tgtcatatcg       540
     gccgggacgt actgtggcaa gaccacgtgc ctcaatgcgt tggtgcagga aatccccgcg       600
     cacgagcgca tcgtcacgat tgaagactca cgggaaatcg agccggcgca accaaactgc       660
     gtgcgccttt cctacgcgcg ccatcaggca tcggggcaag ctgccgtgac gcccacaacg       720
     ttgcttcgct cgtgcatgcg actcaccccc gaccgggtca tcatgggcga gattcgcggc       780
     ccggaagcgg ttgagttctt gaacatgctc aacacgggcc acaagggatc gctcacgacg       840
     attcacaccg attcgccggc cgaaatgtat gaccgctttg gcgagttgat ggacggtcac       900
     acgtcgatga cgcgcgagca ggtcatcgcg cgcgtcaagc gacgaatcga cgttgttgtg       960
     cagtggaaat acaccgagcg caacggtcgc tacatttcgg agatcatcta tgcaggtgcg      1020
     tga                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page