(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB2

AM039950.VIRB2       Location/Qualifiers
FT   CDS_pept        complement(37332..37709)
FT                   /transl_table=11
FT                   /gene="virB2"
FT                   /locus_tag="XCVc0042"
FT                   /product="type IV secretion system protein VirB2"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19811"
FT                   /db_xref="GOA:Q3C0C1"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19811.1"
FT                   /translation="MEKNEAIEKDTAVGPRKGDKVDKALGLTANALVMALVFLPQLAYA
FT                   QDAGGTFGGITAFLKSITQLLIYEWGYYIGIITLAIQGYRWKSGRIDLMTLGGWGLGIG
FT                   LVFFAPNIVSDLKARSSGSIQ"
     atggaaaaga acgaagcgat tgaaaaggac acggcagtag gcccgcgcaa gggcgacaag        60
     gtagacaagg cactcggtct gaccgcgaac gccctcgtga tggccctcgt ctttcttccg       120
     cagctcgcat atgcacaaga cgccggtggc acgtttggcg ggatcaccgc cttcctgaag       180
     tcgatcacgc aattgctcat ttatgagtgg ggctactaca tcggcatcat caccttggcg       240
     atccaagggt atcgttggaa gtcgggccgc atcgacctga tgacgctcgg cggttggggg       300
     ctcggtatcg gccttgtgtt cttcgcgccg aacatcgttt ccgacctcaa ggcgcgttcc       360
     tccggttcga tccaatga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page