(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB4

AM039950.VIRB4       Location/Qualifiers
FT   CDS_pept        complement(34380..37013)
FT                   /transl_table=11
FT                   /gene="virB4"
FT                   /locus_tag="XCVc0041"
FT                   /product="type IV secretion system protein VirB4"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19810"
FT                   /db_xref="GOA:Q3C0C2"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19810.1"
FT                   /translation="MSLSMPVPEGAAADAKEMALSDMIPYTVHYDDESVITKDDGLVQV
FT                   IKLDGLYFESLTAEQIKQFERRRNTVLRSIANSDRGVYVHLIRRKVNLYPAGEGGTWFA
FT                   RRFNQAWRERYNKRSFYVNEIYISIVRNRFRQGAPGILDRAFSLLSGSKVTKEDLESFE
FT                   EQAKDVNEAANLVVQTLSGYGARKLRIQRRPEFVLDRVSRADAQLAVERFKMSWQEFQR
FT                   SHGHHDVYRRDEVLDYLGEDFTEIGGFLHYLVNLEDERVPVTEMQLDRTLAVSSLDFKM
FT                   LSNMMAVQNLSGTRAGAMLSMAEWPARTPSRMLDEFLKQPVEYIITQSFFFTDRISAEH
FT                   DMRQERRRIAVNDREGVAEEDKDEITKGLQDLTRGRSVNGLHHLTMLVHVPATTQFADP
FT                   IENKRQTIADLDGAVGLLKKAFVNLGVKPVREWFAVETFFWAQLPGQAQHFMGRRGKIK
FT                   SGNFAGFASLHNFAVGKIDGNLWGPAIMPFETESGTAYYFNFHREMEGMVAGHLALTAD
FT                   TGGGKTTLLAAFIAMADKARPRVFWFDNREGAKVFMRAMGGQHTTLTVQGNTGWNPMKL
FT                   PDTPENRAYLVELLTLMRTCYGGKLVPDDIDRFKKAVHENYALAYPDRRLRNVAWCFGQ
FT                   GELAKDMRVWHGANGIEGANWGVFDNAHDNIDLTKCRHYCYEMRQLIKDGSARPELPVV
FT                   LSYPFHRIEQSMNGEPFILVLEEGQNLVKHAYWREKIDSYIMQIRRKNGLLVFVTPDAK
FT                   YLYCETDSIQKQTATKIYLPNGEANRTDLVDVLGLTPGEYEFVRDTPPENRTFLIRRGN
FT                   ESIKAKFDLSDMPAFIPVLSSNDKGVALMDEIIRELETDDPEQWVPVFMERALAKNTHN
FT                   LKQKGA"
     atgtcgctgt cgatgccggt gccggaaggt gccgccgccg acgccaagga aatggcctta        60
     agcgacatga tcccgtacac cgttcactac gacgacgaat cggtcatcac caaggatgac       120
     ggtctggtgc aggttatcaa gctcgacggc ctgtacttcg agtcgttgac tgccgagcaa       180
     atcaagcagt tcgagcgccg gcgcaacacg gtgttgcgct ccatcgccaa cagcgaccgg       240
     ggcgtctatg tccacctgat ccgccgcaag gtgaacctgt atccggcagg agagggcggc       300
     acatggttcg cgcggcgctt caatcaggcg tggcgcgagc gctataacaa gcgctcgttc       360
     tatgtgaacg aaatctacat ctccatcgtc cgcaaccgct tccgacaagg tgcgcccggc       420
     atcctggatc gcgcgttttc attgctgtca ggctccaagg tcacgaaaga agaccttgaa       480
     tcgttcgagg aacaggcaaa agacgtcaac gaagccgcta acctcgtcgt tcaaaccttg       540
     tcgggctacg gtgctcgtaa gctgcgcatc cagcggcggc cggaattcgt tctcgatagg       600
     gtaagccgtg ctgatgcgca gcttgccgtc gagcgattca agatgagctg gcaagagttc       660
     cagcgctccc acggtcatca cgacgtgtat cgccgcgatg aagtgctcga ctatctcggt       720
     gaggatttca ccgagatcgg tggtttcctg cactacctgg tcaatctgga agatgaacgc       780
     gtgccggtca cggagatgca gctcgaccgc acgctcgcgg tgtcgtccct cgacttcaag       840
     atgctcagca acatgatggc cgtccagaac ctgagcggca cgcgggccgg ggccatgctg       900
     agcatggccg agtggccggc tcgcacgccg tcgcggatgc ttgacgaatt tctcaagcag       960
     ccggtcgagt acatcatcac gcagtcgttc ttctttaccg accggatcag cgccgagcac      1020
     gacatgcggc aggagcgccg gcgtatcgcg gtcaatgacc gtgagggcgt ggcggaagag      1080
     gacaaggacg agattaccaa gggcctgcaa gacttgacgc gcggtcgctc ggtcaatggt      1140
     ctgcatcacc tgaccatgct cgtgcatgtg ccggccacga cgcaatttgc cgatcctatc      1200
     gagaacaagc ggcagacgat tgccgatctc gacggtgcgg tcgggctgct caagaaagcg      1260
     ttcgtgaatc tcggcgtcaa gccggtgcga gagtggttcg cggtggagac gttcttttgg      1320
     gcgcagcttc ccggtcaggc gcagcacttc atgggccggc gcggcaagat caagtcgggc      1380
     aatttcgccg gcttcgcctc gttgcacaac ttcgcagtcg gcaagatcga cggcaacctg      1440
     tgggggccgg ccatcatgcc tttcgagaca gaaagcggaa cggcctacta cttcaacttc      1500
     catcgcgaaa tggaagggat ggtcgccggt catttggcgc tcacagcgga caccggtgga      1560
     ggtaagacaa ccttgctggc cgcgttcatt gcgatggccg acaaggcccg tccgcgtgtg      1620
     ttctggtttg ataaccgcga aggcgcaaag gtgttcatgc gtgcaatggg cggccagcac      1680
     acgacgctga ccgtgcaggg caatacgggc tggaatccga tgaagttgcc cgatacgccg      1740
     gagaaccgcg cctatctggt cgagctgctc acgctcatgc gcacatgcta cggcggcaag      1800
     ctcgtgcccg atgacattga tcgcttcaag aaggctgtcc acgagaacta cgcgctggcc      1860
     tatccagatc gccgcctgcg caacgtggcg tggtgcttcg gccaaggcga gttggcgaag      1920
     gacatgcggg tatggcacgg agccaacggc atcgagggcg cgaactgggg cgtgttcgac      1980
     aacgcgcacg acaacatcga cctgaccaag tgccggcact actgctacga gatgcggcag      2040
     ctcatcaagg acggctcggc tcggcctgag ctgccggtcg tgctgagcta ccccttccat      2100
     cgcatcgagc agtcgatgaa cggcgagccg ttcatcctcg tgctggaaga agggcagaac      2160
     ctcgtcaagc acgcgtattg gcgcgaaaag atcgacagtt acatcatgca gattcgccgc      2220
     aagaacggtc tgctggtctt tgtcacgccg gatgccaagt acctctactg cgaaacggac      2280
     tcgatccaga agcagacggc aacgaagatc tatttgccga acggcgaagc caaccgtact      2340
     gaccttgttg acgtgctcgg cctaacgccg ggtgagtacg agttcgtgcg tgacacccct      2400
     cccgagaacc ggacgttcct gattcggcgc ggtaacgagt cgatcaaggc gaagttcgat      2460
     ctctccgata tgcccgcgtt catccctgtg ctgtcctcca acgacaaggg tgtggcgctc      2520
     atggacgaaa tcattcgtga gctggaaacc gacgatcccg aacagtgggt gccggtgttt      2580
     atggagcgtg cacttgccaa gaacacgcac aacctcaagc agaaaggagc atga            2634
//

If you have problems or comments...

PBIL Back to PBIL home page