(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB5

AM039950.VIRB5       Location/Qualifiers
FT   CDS_pept        complement(28134..28706)
FT                   /transl_table=11
FT                   /gene="virB5"
FT                   /locus_tag="XCVc0035"
FT                   /product="putative type IV secretion system protein VirB5"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19804"
FT                   /db_xref="InterPro:IPR014158"
FT                   /db_xref="InterPro:IPR023220"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19804.1"
FT                   /translation="MATVLQLQQQFQQLQEQYKTLKDQYAAVTGSYGRGQMGLSDSISS
FT                   ASVVPGSWQEVVAQQQSGAFGSKQAAYEKLINTMPQDLFANPQAQNATTYKMSTDAVRA
FT                   ALAGGDSLYAEVQTHLNNLARMSQQVDTTVNIKDAQDLQNRIAGENGMMQSAMAKLNAM
FT                   NMNLQANMVNQQNQATAANQNFYQWKK"
     atggcaacgg tgctccagtt gcaacagcag tttcagcagt tgcaggagca atacaaaacc        60
     ctcaaggatc agtacgccgc cgtcacgggc agctatggcc gtgggcaaat gggcctgagc       120
     gattccatca gctcggcctc ggtggtgcct ggttcgtggc aggaagtcgt tgctcagcaa       180
     cagagtgggg cgttcgggtc gaagcaggcc gcctacgaga agctcatcaa cacgatgccg       240
     caagacctgt tcgccaatcc gcaggcccag aacgccacga cgtacaagat gagtaccgat       300
     gccgtgcggg ctgcgttggc cggtggcgac tcgttgtatg ccgaagtgca gacgcacctc       360
     aacaatctgg cgcgcatgag ccagcaggtc gatacgacgg tgaacatcaa ggacgctcag       420
     gacttgcaga accgcattgc gggcgagaac gggatgatgc aaagcgcgat ggcgaagctg       480
     aacgcgatga acatgaacct acaagccaac atggtgaacc agcagaacca agccacggcc       540
     gcaaaccaga acttctacca gtggaagaaa taa                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page