(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB6

AM039950.VIRB6       Location/Qualifiers
FT   CDS_pept        complement(26614..27480)
FT                   /transl_table=11
FT                   /gene="virB6"
FT                   /locus_tag="XCVc0033"
FT                   /product="type IV secretion system protein VirB6"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19802"
FT                   /db_xref="GOA:Q3C0D0"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19802.1"
FT                   /translation="MATLTIEGMIGSADGVTTSFLTQIYPALANAISTPIYLVAVLYWA
FT                   IYGYKIYAGYEPMKWNAVLSKAFMTTAVFSALNWGGLGQSIYGFFTSFMEGAASTIMAG
FT                   QSTPSMLDALYNNVGQVSALMQNVSWYQFGMILQGFGLFLINCILFILALVYMTIAKFG
FT                   LAITMVLLPIFVGFFFFEQTRQWAMNWLSKMLNFCFIYILVIAIVRFGFLAFGDAIDEA
FT                   GKAASVTDAARINVQQVAYLYIVEGVLIIFMLQVKGWAAALAGGASVQGVSLLMMVGRM
FT                   FTKGAIK"
     atggcgacac tgaccattga gggaatgatt gggtctgccg acggcgttac cacctcgttc        60
     ctgacacaaa tctatccagc tcttgcaaac gcgatttcca cgccgatcta tttggtggcg       120
     gtgctgtatt gggcgatata cggctacaag atatatgccg gatacgagcc gatgaaatgg       180
     aacgcggtgc tctcgaaagc cttcatgaca acggccgtgt tctcggcctt gaattggggc       240
     ggtttaggcc agagcatcta tggatttttc acgtcgttca tggaaggcgc agcgtcaacg       300
     atcatggccg gacagtccac gccttcgatg ctagacgctt tgtataacaa cgttggtcag       360
     gtgtcggcct taatgcagaa cgtgagctgg tatcagttcg gcatgatctt gcagggcttt       420
     ggcctcttcc tcatcaactg catcctgttc attctcgccc tcgtctatat gaccattgcc       480
     aagttcggct tggctataac gatggtcctg ctgcctatct tcgtcggctt ttttttcttc       540
     gagcaaacgc ggcagtgggc catgaactgg ctgagcaaga tgctgaattt ttgcttcatt       600
     tacatcttgg tcatcgccat cgttcgcttt ggcttccttg cgtttggcga tgcgattgat       660
     gaggccggca aagcggcgag tgtgaccgat gcggcgcgta ttaacgtcca gcaagttgcc       720
     tacctctaca tcgtcgaagg cgtcttgatc attttcatgc tgcaagtcaa aggttgggcc       780
     gccgcactcg cgggcggtgc atcggtgcag ggcgtgtcgt tgttgatgat ggtgggccgg       840
     atgttcacca aaggagcaat caaatga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page