(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB8

AM039950.VIRB8       Location/Qualifiers
FT   CDS_pept        complement(25943..26617)
FT                   /transl_table=11
FT                   /gene="virB8"
FT                   /locus_tag="XCVc0032"
FT                   /product="type IV secretion system protein VirB8"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19801"
FT                   /db_xref="GOA:Q3C0D1"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19801.1"
FT                   /translation="MNFGKGTFKGDNETQAAQLGGSNKLKQERNRAYLLIGLLLFVVGG
FT                   MASAVTVLANVHTVIPVVSVIDANGHVVKQQVVNKETITGQESFVQSQVYDFIMYCNTF
FT                   DPDWRQRFADLCRLHSTQAVAGQYDAETSPDNPNNPYYQLGQGGRRYPKITGITSLGKD
FT                   AYQVSFQSITEKAGSPPKTDYYTALVRYTFTFKPLALGDRWENALGYATTAYRKDQELS
FT                   RQ"
     atgaatttcg ggaaagggac gtttaaaggc gacaacgaga cgcaggcggc ccaattgggc        60
     ggctcgaaca agctcaagca agaacgcaac cgcgcgtatc tgctcatcgg gttgctgctg       120
     ttcgtcgtcg gcggcatggc gagtgcggtc acggtgctcg ccaacgttca cacggtcatt       180
     cccgtggtgt cggtcatcga cgcgaacggc catgtggtga aacagcaggt ggtgaacaag       240
     gaaacgatca cggggcagga aagcttcgtt cagagtcagg tgtacgactt catcatgtac       300
     tgcaacacgt tcgacccgga ctggcggcag cggtttgctg acctctgccg gctgcactca       360
     acgcaagcgg tggcaggcca gtacgacgcg gaaaccagcc ccgacaaccc gaacaacccg       420
     tattaccagc tcgggcaggg cggtcggcgc tacccgaaga tcacgggcat tacgtcgctc       480
     ggcaaggatg cgtatcaggt gtcgttccag tcgattacgg agaaggcggg gagcccgccg       540
     aagaccgact actacaccgc gctcgtccgc tacaccttca cgttcaaacc ccttgcactt       600
     ggcgaccgct gggaaaacgc gcttggctac gccacaacgg cctaccgcaa ggaccaagag       660
     ctgagccgcc agtaa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page