(data stored in ACNUC9435 zone)

EMBL: AM039950.VIRB9

AM039950.VIRB9       Location/Qualifiers
FT   CDS_pept        complement(25136..25918)
FT                   /transl_table=11
FT                   /gene="virB9"
FT                   /locus_tag="XCVc0031"
FT                   /product="type IV secretion system protein VirB9"
FT                   /db_xref="EnsemblGenomes-Gn:XCVc0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19800"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014148"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0D2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19800.1"
FT                   /translation="MKFNPIALAVALIAGTSISLASVPAHAAKSPHALVTDDRVKQVPY
FT                   DPNQVYEIVGTYGYQTSIEFANDETVKVVTLGDSIAWQTVPYQNRLFLKPVEPNAATNL
FT                   TVITDKRTYYFKLTSSKSQAAMTFLVRFVYPNSNVKTYAGAGSAQRMSNGFDPAKLNLG
FT                   YGTSGNKTAIPLKRAFDDGQFTYFMFDQNAEIPSVYTVGPDGTETIVNTRREGQYLVVE
FT                   RTASLFTLRNGNAHLCVQNNANPYKRAVSGLVSTGGGN"
     atgaaattca accctattgc tctcgctgtt gccctcattg ctggcacgtc gatttcgctg        60
     gcctcggtgc cggcccacgc ggcgaagtcg ccgcatgcgt tggtgacgga tgatcgcgtc       120
     aaacaagtgc cgtatgaccc gaatcaggtc tacgagatcg ttggcacgta tggctaccag       180
     acctccatcg agttcgccaa tgacgaaacg gtcaaggtcg tgacgttggg cgattcgatt       240
     gcatggcaaa ccgtgccgta ccagaaccgc cttttcctca agccggtgga gccgaacgca       300
     gccacaaacc tgaccgtgat taccgataag cgcacgtact acttcaagct gactagctcc       360
     aagagccaag cggcgatgac gttcctggtc cgcttcgtct atccgaactc gaacgtgaag       420
     acatacgccg gcgcgggcag cgcgcagcgc atgagcaacg ggttcgatcc ggccaagctc       480
     aaccttggct acggcacgtc gggaaacaag acggccatcc cgttgaagcg cgctttcgat       540
     gatggccagt tcacctattt catgttcgac cagaacgcag aaatcccttc ggtgtacacc       600
     gttggcccgg acggcacaga gaccatcgtc aacacgcgac gcgaggggca atacctggtg       660
     gttgaacgca cggcaagcct gttcacgctg cgcaatggca acgctcacct ctgcgtgcag       720
     aacaacgcca atccctacaa gcgcgctgtg agtggcctgg tgagcactgg cgggggcaac       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page