(data stored in ACNUC9435 zone)

EMBL: AM039951.DOTA

AM039951.DOTA        Location/Qualifiers
FT   CDS_pept        complement(32545..35127)
FT                   /transl_table=11
FT                   /gene="dotA"
FT                   /locus_tag="XCVd0027"
FT                   /product="putative TraY/DotA-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19839"
FT                   /db_xref="GOA:Q3C077"
FT                   /db_xref="InterPro:IPR027628"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C077"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19839.1"
FT                   /translation="MAAPTPMKPGRSPEPRPPHVASFVRHQGTPRSGAKLSPAARGGET
FT                   RCHRACSACGAAMAGLGHPTHLAPKHHRWNFWLHAHFPFPCPVTPKCRRYFRGHHALTW
FT                   SYSMTRSLAVLGALMIPNLARAQDPSKPGFFKPPADDTSVSFIRDVFGSIVDTIMTGQN
FT                   VDQASADTALAAGFEVFGLGILALGMLFVIFTTVKGAVDTAHDGEFLGKKMSSVWVPLR
FT                   TAAGTAFLLPLKSGFSLVQIAVLWIGIHGVGLADQVWLAMLDKMVETGQMGRPHLPDSR
FT                   PLAANILRYEVCAAAMNKQYETEGRALKIEVLPKKTAMINTGDALKFDNILYPGGFLDL
FT                   AQSAAGSAFSVTGLQWSAVGSGGYMNQNVCGELEWQESHESSESNGAPYIDKAPILRAQ
FT                   AQAVQKMVSELRPVAQAIVAGEKPAAGALERVANTYELSLQTAALSVVNRANKNRNSRF
FT                   LTYAKEGGWIFAGTYYNHIIHMSDAIQSAVNSLPASSAQTITDKEAADTLILYQDSLVT
FT                   ANEYIRNSSQSAYRAYEAQNQAIGFTGDKIPSNFEEMKIWLSRPALAGINQMTQEIAGS
FT                   NLSHVAQMKNVGDTIMAVAWTIQGAQFIVAGFGGGLWDDAVTLGSYDIGASIETLTPAV
FT                   AFLFMTLLTAGAFLAFYVPMIPYIIWITGIIKWLTVLFESVIAAPIWAAAHVHPDGDDQ
FT                   GGRAGPGYMIILSVFLRPTLMIFGLVGSIVVAQPVAHYVNLTYITQVQGAMGNSANAIG
FT                   ALIAYTAIYAILMTIVLHSVFGFINWIPDNVLRWIGSAVGMHGIADNEEHGVKGAFFRS
FT                   TESVSKGTGSHKPSGGGGGGSKPVNTGGSEPGGGGTGNDVHSTKLPGA"
     ttggctgcgc ctactccgat gaagccaggc aggagccccg aaccgagacc accacatgtt        60
     gcgtcgtttg tccgacatca aggcacgccc agatccggcg ccaagctcag ccccgccgcc       120
     cgtggcggtg aaacccgttg ccatcgcgcc tgcagcgcct gcggcgccgc gatggcagga       180
     cttggccacc cgactcacct cgcacctaaa caccaccggt ggaacttctg gctccatgcc       240
     cacttcccat tcccatgccc cgtcacgccc aagtgccggc ggtacttccg aggacaccac       300
     gccctcacct ggagctactc catgacacgt tcgctcgcgg tgctgggtgc actgatgatt       360
     cctaaccttg cgcgcgcgca agatccctca aagcccggtt tcttcaagcc gccggcagac       420
     gacacaagcg tatctttcat tcgagatgtg ttcggctcga tagtggatac gatcatgacc       480
     ggccaaaacg tagatcaggc ctcggcagac acagcattgg ctgcaggatt cgaggtgttt       540
     ggccttggaa tcctcgcgct gggtatgttg tttgtgattt tcaccacggt caagggagcg       600
     gttgatacag cccacgatgg tgagttccta ggcaagaaaa tgtcgtctgt ctgggttccg       660
     ttgcgtaccg cagcgggtac tgcgtttttg ctacccctaa agtcgggatt ttcgttggtc       720
     caaatcgcag tgctttggat aggcatacac ggggtcggcc tggctgacca agtgtggttg       780
     gctatgctcg ataaaatggt agagaccggg caaatggggc gcccgcattt gccggattcg       840
     cggcctcttg ccgccaacat ccttcgctat gaagtatgtg ctgcagcaat gaacaagcag       900
     tacgagaccg aaggcagggc gctgaaaatc gaggtattgc ccaagaagac agccatgatc       960
     aacacgggcg acgcactcaa gttcgacaac atcctgtatc cagggggatt tctcgatctt      1020
     gcccaaagcg cggctggttc tgccttcagc gttactggcc tgcagtggtc agctgtgggc      1080
     tcaggtgggt atatgaatca gaatgtatgt ggagagcttg agtggcaaga gtcccacgaa      1140
     tcgtctgaaa gcaacggcgc gccctacatt gacaaggcgc cgatcttgcg cgctcaagca      1200
     caggccgtcc aaaagatggt cagtgagctg cgtcctgtag cgcaagccat cgtggcgggt      1260
     gaaaaacctg ctgctggcgc tctcgaaagg gttgcaaaca cctacgagct ttccctgcag      1320
     acagcggcac tcagtgtagt gaatcgcgca aataagaata gaaacagtcg attcctcacc      1380
     tatgcaaaag agggtggctg gatattcgcc ggcacctact acaaccacat catccatatg      1440
     agcgatgcga tccaatcagc ggtcaattcg ctcccagcat cgagcgcgca gacaattacc      1500
     gacaaggagg ccgctgacac actgatcctc tatcaggact cgcttgtcac ggcgaacgag      1560
     tacatccgca atagctccca atccgcgtac cgagcatatg aggcgcagaa ccaagcgatt      1620
     ggttttaccg gtgacaagat tccctcaaac ttcgaagaaa tgaaaatatg gttgtctcgt      1680
     ccggccctgg ctggcatcaa tcagatgact caggaaattg caggaagcaa tctatcccac      1740
     gttgcacaga tgaagaatgt gggggacacc atcatggcag tcgcgtggac aattcaaggt      1800
     gcgcaattca ttgttgccgg ctttggcggc ggcctatggg acgatgcggt cacgctggga      1860
     agctatgaca taggcgccag catcgaaacc ttgacgcccg cagtcgcctt ccttttcatg      1920
     acactgctga cggccggtgc atttctggcc ttctacgtac caatgattcc ctacatcatc      1980
     tggattacgg ggatcatcaa gtggttgacc gtgctcttcg agtctgtgat tgcggcgcca      2040
     atctgggcag cagcccatgt ccatcccgat ggcgatgacc agggcggacg cgccggccct      2100
     ggctacatga tcattctgtc cgtgttcctg cggccaacgc tgatgatctt cggcctagtt      2160
     ggttccattg tcgtcgcgca accggtcgca cactacgtca accttacata catcacgcaa      2220
     gtgcaggggg cgatgggcaa ctctgcaaac gcaatcggtg cattgatcgc gtataccgcc      2280
     atttacgcaa tcctgatgac tatcgtgctg cattcagtgt tcggatttat caactggatc      2340
     ccggacaatg tcttgcgctg gatcggctct gcggttggta tgcacggcat cgccgacaac      2400
     gaggaacacg gtgtgaaggg cgcctttttc cgcagcactg aatccgtgtc taagggcacc      2460
     ggctctcata agcccagcgg cggcggcggc ggcgggagca aacccgtcaa tacgggaggc      2520
     agcgagcctg gtggtggtgg cactggaaac gacgtccatt caaccaagct tccgggagcc      2580
     taa                                                                    2583
//

If you have problems or comments...

PBIL Back to PBIL home page