(data stored in ACNUC9435 zone)

EMBL: AM039951.DOTB

AM039951.DOTB        Location/Qualifiers
FT   CDS_pept        7844..9040
FT                   /transl_table=11
FT                   /gene="dotB"
FT                   /locus_tag="XCVd0007"
FT                   /product="putative DotB-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19819"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C097"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19819.1"
FT                   /translation="MNAVLSDQSLIERALLRSEPTVFDEIGVQQLLVHAKAMGASDVYI
FT                   KTNARVTARIHGRLYRLTRRTLYATEVGSIAGYLYGGPNAEVQLKRGMDLDNAYTFRLN
FT                   RSDSLRFRWNATGAEIDGSFGISIILRELPEIPPAIDKEDLGDDLYGALYPDDGIVMVC
FT                   GPTGSGKSTLLAGMIRDIAENPDSHCHIITYESPVEFVYDKVEKPTTEIESTSIPDHLP
FT                   NFAAAIRNSLRRDPDIIVVGEMRDGETIGAAILASQTGHVVYGTAHSTSVGATFTRTMQ
FT                   SLPKNEQQGMLGGLIDSLRLIICQELVQSTDGKRVALREYLSFGESERRALLTAAMRDP
FT                   AGVPSVAQQLTRERGQTKLMHARKLFAAGRIKEDVVLRFELAEQTARAQVSLLAGEGE"
     atgaacgcgg tgctctccga ccagagcctg atcgagcggg cgctgctgcg atcagagccg        60
     actgtcttcg acgaaatcgg tgtccaacag cttctggtcc atgccaaagc gatgggcgcc       120
     tcggacgtat acatcaagac gaatgccaga gtcaccgcgc ggatccacgg ccggctgtac       180
     cggctcacgc gccgcacgct gtatgcgacg gaggtgggct ccattgccgg ctacctctac       240
     ggcgggccca acgccgaggt tcagctcaag cgcgggatgg acctggacaa tgcatacaca       300
     ttccgcctca atcgctccga ctcgctgcgc ttccgttgga acgcgaccgg cgcggagatc       360
     gacgggtcgt tcggtatctc gatcatcctc cgcgaacttc ccgagattcc accggcaatc       420
     gacaaagaag acttgggcga tgacctctac ggcgccttgt acccggacga cggcatcgtg       480
     atggtttgcg gtccgaccgg atcaggcaag tcgaccctct tggcgggcat gattcgggat       540
     atcgcagaga accccgattc gcactgccac atcatcacct acgagtcgcc ggtggagttt       600
     gtctacgaca aggtcgagaa gccgacgact gagattgaat cgacctccat cccggatcac       660
     ctgccgaact ttgccgctgc aatccgcaac tcgctccggc gtgacccaga catcatcgtg       720
     gtcggtgaaa tgcgcgacgg cgagacgatt ggtgcggcca tccttgcttc gcagacaggt       780
     cacgtggtgt atggaacggc acacagtact tctgtcggcg ctactttcac acgcaccatg       840
     cagagcctgc cgaagaacga gcagcaggga atgttgggtg gcctcatcga ctcactgcgc       900
     ctcatcatct gtcaggagct cgtccagtcc accgacggca agcgcgtggc gttgcgtgag       960
     tacctgtcat tcggggaaag cgagcgccgc gcgctcctga ctgccgccat gcgggatcct      1020
     gcaggtgtgc catcggtcgc gcagcagctc acccgcgagc gcgggcagac caagctgatg      1080
     cacgcacgca agcttttcgc tgccggtcgc atcaaagagg acgtggtact ccgcttcgag      1140
     ctcgccgagc agaccgcaag agcgcaggta agtttgctgg ccggggaggg tgagtga         1197
//

If you have problems or comments...

PBIL Back to PBIL home page