(data stored in ACNUC9435 zone)

EMBL: AM039951.DOTC

AM039951.DOTC        Location/Qualifiers
FT   CDS_pept        7068..7847
FT                   /transl_table=11
FT                   /gene="dotC"
FT                   /locus_tag="XCVd0006"
FT                   /product="putative DotC-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19818"
FT                   /db_xref="InterPro:IPR031618"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C098"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19818.1"
FT                   /translation="MAVSDAPPNLDQALGAFERNGAEVRVIDAVGELRASAIREDGLSY
FT                   GVRAGLARRSFEIQQLLAKQAPQLDRAFDFGSLLMDRNVLPPVLTEASQVVHSEGTDVL
FT                   RVTDKIYAIARQAQFVTAAPTWRSYVVTEATFSYDPPEPYMAPKSGDERTVWKQAVTTG
FT                   WKAGEQQADQILTESLNRLKRDYQGMLLYRRLLQQGVVSKPYVAEANYGITGDGDKVNI
FT                   NERMLRITALPKMQPHTQWKPIAVPAKPIQPTVRVNP"
     atggcggtct ctgatgcccc gccgaaccta gaccaggcgc ttggtgcgtt cgagcgaaac        60
     ggtgctgagg tccgtgtgat tgacgcggtt ggcgagttgc gcgcgtccgc cattcgtgag       120
     gatggactgt cgtatggcgt tcgcgctgga cttgcccggc gctctttcga gatccagcag       180
     ctgctggcca agcaggcacc gcagctggac cgagcctttg atttcggctc cttgctcatg       240
     gatcgcaacg tccttccccc ggtgctgact gaagcgagtc aggtcgttca ttcagagggc       300
     accgacgttc ttcgtgtcac cgacaagatc tatgcgatcg cgcgtcaagc acagttcgta       360
     acggccgccc ctacctggcg ctcgtacgtc gttaccgagg cgaccttctc ctatgaccca       420
     cccgagccat acatggcacc caagagtggg gatgagcgaa cggtatggaa gcaggcggtc       480
     acgaccggtt ggaaggcagg ggagcagcag gcagaccaga tcctaaccga atcgcttaac       540
     aggcttaagc gtgactatca gggaatgctg ctgtaccggc gcctgcttca acagggcgtc       600
     gtcagcaagc catatgtggc cgaggccaac tacggaatca caggcgacgg ggacaaggtg       660
     aacatcaacg agcgcatgct gcgcatcact gcgctgccca aaatgcagcc gcacacacag       720
     tggaagccaa tcgcggttcc ggcaaagccc attcagccaa ctgttcgggt gaacccatga       780
//

If you have problems or comments...

PBIL Back to PBIL home page