(data stored in ACNUC9435 zone)

EMBL: AM039951.DOTD

AM039951.DOTD        Location/Qualifiers
FT   CDS_pept        6587..7081
FT                   /transl_table=11
FT                   /gene="dotD"
FT                   /locus_tag="XCVd0005"
FT                   /product="putative DotD-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19817"
FT                   /db_xref="InterPro:IPR031817"
FT                   /db_xref="InterPro:IPR038140"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C099"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19817.1"
FT                   /translation="MRRYQAVLLATCAALSAGCATTRSAGPSASDPAQENLTAAASAIQ
FT                   QSLRDLSEAEQYDKMRAVPGTPRLRTQIPGLERMVTMPWNGPLEPAVMRLAAEGGYEFK
FT                   LLGRQPAVGIVVQVGPEPATISDHLRNLGIQAGTRADIAIEPTAGGRRGIIAIEYSNGG
FT                   L"
     atgcgtcgct accaagctgt cctcctcgcc acctgcgcgg ctctatccgc tggctgcgcc        60
     accaccagat cagcgggacc atccgcgtcg gacccggcgc aggagaatct caccgccgcg       120
     gcatcggcca tccagcaatc gttgcgcgac ctctcggaag cggagcaata cgacaagatg       180
     cgagccgtgc ccggcacccc gcgtcttcgc acgcagattc cgggcctgga gcggatggtg       240
     accatgcctt ggaacggtcc gctggagcca gccgtcatgc gtttggctgc ggagggcggc       300
     tacgagttca agcttctcgg caggcaaccg gctgtaggca ttgtggtgca ggtcgggccc       360
     gagcccgcaa cgatctccga tcacctgcga aatctgggca ttcaggccgg cactcgcgct       420
     gacatcgcaa tcgagccgac tgctggcggg cgccgcggca ttatcgcaat cgagtacagc       480
     aatggcggtc tctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page