(data stored in ACNUC9435 zone)

EMBL: AM039951.DSBC

AM039951.DSBC        Location/Qualifiers
FT   CDS_pept        144018..144770
FT                   /transl_table=11
FT                   /gene="dsbC"
FT                   /locus_tag="XCVd0137"
FT                   /product="thiol:disulfide interchange protein"
FT                   /EC_number="5.3.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19949"
FT                   /db_xref="GOA:Q3BZW7"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19949.1"
FT                   /translation="MNRLALPLLLTLSLAACGDDSTPNASSGLDLAQAAVSKLAPHAKV
FT                   TGVERAAVPGLLQVTVDGSQVIYISENGQHLLAGQIIELASKDNLTERATSALHRKMLA
FT                   ELPPERKIVYAAEDPKHTVTVFTDVDCGYCRMLHEHIPDYNKAGISIEYVLYPRSGLQS
FT                   PTYATSVSVWCAQDRKQALIAVSTGGELTPAQCTNPVAEDYALGQRLGVTATPAIFAED
FT                   GRQVGGLLPPAQLLAVLDGRAQRGPTQP"
     atgaatcgcc tcgcacttcc ccttcttctc accctctcgc tggccgcctg cggcgacgac        60
     tcgacgccga acgcgagctc tggccttgat ttggcgcaag cagctgtcag caagcttgcg       120
     ccgcacgcga aggtgaccgg cgtcgaacgc gcagcagtgc ccggcctgct gcaggtcacg       180
     gtcgacggat cccaggtcat ctacatctcg gagaacgggc aacacctgct ggccgggcag       240
     atcattgaat tggcttcgaa agacaacctg accgagcgcg cgacaagcgc cttgcacaga       300
     aagatgctgg ccgagctgcc gccggagcgc aagatcgttt acgcggccga ggatcccaag       360
     cacaccgtga ccgtgttcac ggacgttgac tgcggatact gccggatgct ccacgagcac       420
     atccccgact acaacaaggc cggcatcagc atcgagtacg tgctgtatcc acgcagcggc       480
     ctgcaatcac cgacgtatgc aacctccgtc agcgtctggt gcgcgcagga tcgcaagcag       540
     gccctcatcg cggtctcaac cgggggcgaa cttacgccag cgcaatgcac caatcccgtg       600
     gccgaggact atgcccttgg acaacgcttg ggtgtgacgg cgacgccggc catcttcgcc       660
     gaggacggcc gtcaggtcgg cggcctcttg ccgccggcgc agctgctggc cgtactcgac       720
     ggccgggccc agcgaggtcc gacacagcca tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page