(data stored in ACNUC9435 zone)

EMBL: AM039951.ICMB

AM039951.ICMB        Location/Qualifiers
FT   CDS_pept        complement(169614..172661)
FT                   /transl_table=11
FT                   /gene="icmB"
FT                   /locus_tag="XCVd0162"
FT                   /product="putative IcmB-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19974"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19974.1"
FT                   /translation="MKIVEQIADIAEGALAYFSSSVKQSVADYLDIEYTEDETTFVLKD
FT                   GSRMTLLRVNGSRRMIGVDEFREIDGRLTNSLKAFMRGGGHALSCIFESDPDLVEREVR
FT                   EAQKPMRDTAVRIGLNLEDLFEEDVAMLRESCSAERCWVALYTRPSAFTATELKRDVAA
FT                   RMELLKDNPIPTMEDAPNLFRVIAGLKSRHDSFVSSFMQEMAAAEISLVQLEVHDACRD
FT                   MRMSIDREFTAAEWRPSLPGDKIPVREQRRNPADMSGALWPRLDRQLAPRNIREESSTS
FT                   CTVGSIAYKPMYIFMHQSGSETVPFQALFRRVRDTRAPWRIKFQIESGGLTSLGFKRLI
FT                   TAIIGFTNPENGLMRAAADRIEYLVREQNELDVKLRVDLTSWAPAGNAKLLEDRTSKLA
FT                   RAVQAWGGTDVRELSGDPVQALVATTPGLSLNSPATVACAALADVTQMLSFYRPASPWD
FT                   FGALMFNSPDGKLFPFQPSSSVQSNWINTVIAEPRAGKSVLVNAMNLAFTLSPGLTDLP
FT                   YIAIIDIGRSSSGFTSLIREAATEQSKHQVVQFRMRMRPEDSVNPFDTQLGCRRPLPHE
FT                   EALAVNFTTLLMTPPGEPHPADGMAGLCAGVIDYAYKHFADNAQPRRYSPQTEGAELVD
FT                   RAIVAHGLHVDRNTTWWEIVDQLFSRGDIHAASLAQRYAVPTLTDLAAVSRERQFSDLY
FT                   GEKLTNSGEPLLQAFARMLSEAIRRYPILSRPTAFDVGDARIVSIDLDEVAKQGSAVAD
FT                   HQTNVCYMLARHAAARNFYLREEHIDSFPPEYKGHHEQRIREIRQNRKHLVFDEVHRTS
FT                   KAAAVQNQLELDAREGGKWGVMLTLISHRPQDFPEAVLSFSTGNFVLSPTDDDSAELMR
FT                   DKWQASPTVLHAAKKHIRPPTAKDGSTMVVIFKTRSGPVTQLLNLKMGGIRLWAFSTSN
FT                   EDSYVRDVLYSQIGGQETRRLLAALYPAGTLLPEIERRKLALQNSGVMVDSEKEDGVIN
FT                   ELIREIKGKYDAARLQGAVAQGDRRA"
     atgaagatcg tcgagcaaat cgcagatatt gctgagggcg ccctcgcgta cttcagtagt        60
     tcagttaagc agagcgttgc tgactacctg gacatcgaat acaccgaaga cgagaccacc       120
     ttcgtgctca aggatggctc tcgcatgacg cttcttcgag tcaatggttc cagacgcatg       180
     attggtgttg atgagtttcg tgagattgat ggacgcctga caaattcact caaggcattc       240
     atgcgtggtg gtggtcatgc gctgtcgtgc atcttcgaat ctgatccgga cctcgtcgag       300
     cgcgaggtgc gtgaagcgca gaaaccgatg cgggacactg ctgtccggat tggtctgaac       360
     ctcgaagatc tctttgagga agatgtcgcg atgctgaggg agtcctgcag cgctgagcgc       420
     tgctgggtcg ctctctatac tcgcccatcg gcatttaccg ctaccgagtt gaagcgcgat       480
     gttgcggcgc gcatggagct gctgaaagac aatcccattc ccacgatgga agatgcaccc       540
     aatctgtttc gggtgatcgc tgggctcaag agcagacatg attccttcgt ctcctccttc       600
     atgcaggaga tggcagcggc cgagatttcc ctggtgcagc tggaggtgca cgacgcttgc       660
     cgggacatgc gcatgtcgat tgaccgagag ttcacggcag cagagtggcg cccaagcctc       720
     cccggcgaca agatccctgt gcgcgagcag cggcgaaatc cggcggatat gtctggcgcg       780
     ctgtggccac ggcttgaccg ccagctggcg ccccgcaaca tccgggaaga gagctccacc       840
     tcctgcactg tagggtcgat cgcctacaag ccgatgtaca tcttcatgca ccaatcaggg       900
     agcgagacgg tgccgtttca ggcgctgttc cgccgagtga gggacacccg tgcgccttgg       960
     cggatcaagt tccagatcga gtcgggaggg ctaacctccc tgggctttaa gcgtcttatt      1020
     accgcgatca tcgggttcac caacccggag aacgggctca tgcgtgccgc agctgatcgc      1080
     atcgagtacc tggtacgtga gcagaacgag ctcgacgtga agctgcgggt tgatctcacc      1140
     tcttgggcgc cggcaggcaa cgcgaagctg ctggaagacc gtacatccaa gctcgcccgt      1200
     gcggtgcagg cgtggggtgg tacggacgtc agagagctgt caggcgatcc ggtgcaggcc      1260
     ttggtggcga ccacgccagg gttgagtctg aacagcccgg cgacggttgc ctgcgcggca      1320
     ctggcggatg tcacgcagat gctgagcttc taccgaccgg cgtcaccttg ggatttcggc      1380
     gcgttgatgt tcaattcgcc ggacggcaag ctttttccgt tccagccatc gtcctccgtt      1440
     cagtcgaact ggatcaacac agttatcgcc gagccccgcg cgggtaagtc ggtgctggtg      1500
     aacgcgatga atctggcatt caccctgtct ccaggtctga ccgacctgcc gtatatcgcg      1560
     atcattgaca tcggtcgctc cagctcgggc ttcacctcgc ttatccggga ggcggcgacg      1620
     gagcagtcta agcaccaagt cgtgcagttc cggatgcgga tgcgtcccga ggactccgtg      1680
     aacccattcg acacacagct tggctgccgg cgcccgctcc cgcacgagga ggcgctagcc      1740
     gtcaatttca ccacgctgct tatgacgcct ccgggagagc cgcatccagc tgacggcatg      1800
     gctgggcttt gcgctggtgt catcgattat gcgtacaagc acttcgccga caatgcgcag      1860
     ccgcgccggt acagcccgca aacggagggc gctgaactgg tcgatcgtgc cattgtcgcg      1920
     catgggctcc atgtcgatcg caacaccacc tggtgggaga ttgtggacca gttgttttct      1980
     cgcggcgaca tacacgctgc gtcgctagcg cagcgctacg ccgttccaac gctgacggat      2040
     ctggcggctg tcagccgcga acggcagttt tctgacctgt acggcgaaaa gctgaccaac      2100
     tcgggcgagc cgctgctaca ggcattcgcg cgaatgctat cggaggccat tcgtcgctac      2160
     ccgatcctgt cgcgtccaac ggcatttgac gtgggcgatg caaggatcgt gtcgatcgac      2220
     ttggatgagg tggcaaagca gggtagtgcg gtggctgatc accagaccaa cgtttgctac      2280
     atgcttgcca ggcatgctgc tgcccgcaac ttctacctgc gcgaggagca catcgattcc      2340
     ttcccgcccg agtacaaggg acaccacgaa cagcgaattc gtgagatccg gcagaaccgt      2400
     aaacacctgg tgttcgacga ggtacatcgc acgtcaaagg ctgccgctgt acagaatcag      2460
     cttgagctgg atgcacgaga gggtggtaag tggggcgtca tgctgacgct tatttcgcat      2520
     cggccgcagg acttcccaga ggccgtgctc tcgttctcga caggaaactt tgttctttcg      2580
     ccaacggatg acgattccgc tgagctgatg cgggacaagt ggcaggcatc cccgacagtg      2640
     ctccacgcgg ctaagaagca tatccgccct ccaaccgcga aggatggctc gacgatggtg      2700
     gtgatcttca agacgagaag cgggccggtc acccagctgc tcaacctgaa gatgggcggt      2760
     atcaggcttt gggctttttc gacgtcaaac gaggactcct acgtgcgcga tgtcctttat      2820
     tcacagatcg gcggacaaga aacacggagg ctgctcgctg cgctttatcc ggcgggcaca      2880
     ttgttgccgg agatcgagcg ccgcaagctc gcgctgcaga acagcggcgt tatggtggat      2940
     agcgaaaagg aagatggcgt gatcaatgaa ctcatccgcg agatcaaggg caaatatgac      3000
     gctgctcgtc tgcagggggc agtggcccaa ggtgaccgcc gtgcataa                   3048
//

If you have problems or comments...

PBIL Back to PBIL home page