(data stored in ACNUC9435 zone)

EMBL: AM039951.ICMC

AM039951.ICMC        Location/Qualifiers
FT   CDS_pept        complement(175361..175891)
FT                   /transl_table=11
FT                   /gene="icmC"
FT                   /locus_tag="XCVd0166"
FT                   /product="putative IcmC-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19978"
FT                   /db_xref="GOA:Q3BZT8"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19978.1"
FT                   /translation="MNDVSQMLANLEGVAPYVSALIQTIASLMGVLFTVQGLYKFKQHT
FT                   ERGEAHLGTAFLYLVSGVALVNLALSTDAAFGLLYGNSGASVQHLVAYKPTDSMPTQAA
FT                   MVMKVIVLLLQVYGLFFTVTGWVQVRKLNDNRSGGEVTFRSTMFRILGGAALLNIVLTV
FT                   NTLAKLLGFGRVF"
     atgaacgacg tttctcagat gctggccaac ctggaagggg tcgctccgta tgtcagcgca        60
     ctgattcaaa ccatcgctag cctgatggga gttcttttca ctgtccaagg tctctacaag       120
     ttcaagcagc acaccgagcg cggtgaagca cacctcggaa ccgcattcct ctatctggta       180
     tccggcgtag ctctggtgaa cctcgcactg tcaacggacg ccgcattcgg cttgctatac       240
     gggaattcgg gtgcatcggt gcagcacctg gttgcctata agccaaccga ttcgatgccg       300
     acgcaggccg cgatggtgat gaaggtcatc gtgctgttgc tgcaggtcta cgggctgttc       360
     ttcaccgtga cgggctgggt gcaagtacgc aaactcaatg acaaccgatc aggcggagag       420
     gttacgttcc gctcgaccat gttccgcatt ctcggtggcg cggcactact caacatcgtg       480
     ctcaccgtga acactctcgc gaagcttctt ggcttcggca gagtttttta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page