(data stored in ACNUC9435 zone)

EMBL: AM039951.ICME

AM039951.ICME        Location/Qualifiers
FT   CDS_pept        complement(176852..178099)
FT                   /transl_table=11
FT                   /gene="icmE"
FT                   /locus_tag="XCVd0168"
FT                   /product="putative IcmE-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19980"
FT                   /db_xref="GOA:Q3BZT6"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19980.1"
FT                   /translation="MMAQQESDIKLRAGNIASALKHGPTRLIFIGGIVLSLVVVVLAFS
FT                   FMGGGKPANNGEVVLESVPEPTVAPSGQTLTNTKAYEALAQQSDIQALKQAQQTGGTAM
FT                   PMPRPGQAAAEAKGEVTIDGTGVNMNAVPEPAAAAATTAQAQSAEATARLQQHEQQVQA
FT                   RYAIMSKQYDNLVGRWISVQTPVSVAVNQERKAGEAEDAQVGSASVASTASDDMAETTS
FT                   GALLRANDTYLGITLGDATTDDRLPLVRARILNGPGKGSVMRGTIETSEFAPGGFIHFT
FT                   SLTPPSGAQKRDAVEIDAVAIDPTTSRASVGDVNRHTASRMASLFFSSVLSGVSEGLIA
FT                   GGQQENVVTTGQTVVVQKDAFNDRQLALVGLGKVGTNATQMLQPTINRKPTASIGQKTE
FT                   IGVLFLSDVPASAFGK"
     gtgatggctc agcaggaaag cgatatcaaa ctacgcgctg gcaacatcgc cagcgcgctc        60
     aaacacggac caacccgcct catcttcatc ggtggaattg tcctgagtct ggtcgtggtg       120
     gtgctggcct ttagcttcat gggaggcggc aagcccgcca acaatggcga ggttgtgctt       180
     gaaagtgtgc ccgagccgac cgtcgcaccg agcggccaga cgctgaccaa caccaaggcg       240
     tacgaggcct tggcgcaaca gagtgacatc caagcgctga aacaggcgca gcagaccggt       300
     ggcacggcaa tgccaatgcc acggcccggc caagccgcag cggaagccaa gggcgaggtc       360
     accatcgatg gcaccggcgt gaacatgaat gctgtgccag agccggcggc cgctgccgcc       420
     accacagcgc aggcgcaaag cgccgaagct accgccaggc tgcagcagca cgaacagcag       480
     gtccaggcac ggtacgcgat catgtccaag cagtacgaca acctggttgg ccgctggatc       540
     agtgtgcaaa cgcccgtaag cgtggctgta aatcaggaac gaaaggcagg cgaagcagag       600
     gatgcccaag tgggctcagc gtcggtcgca agtacggcct ccgacgacat ggcggagacc       660
     accagcggcg ccttgctgcg agcgaatgac acgtaccttg ggatcacctt gggggacgcc       720
     acgaccgacg atcgactgcc gctggtacgc gctcgaatcc tcaatgggcc gggcaaggga       780
     agcgtcatgc gcgggacgat cgagaccagc gagttcgcgc ccggcgggtt tattcacttc       840
     accagtctta ctcctcctag cggggcacaa aagcgcgacg cagttgagat cgatgcagtc       900
     gcaatcgatc ccacgacatc gcgcgctagc gtcggtgacg tcaacaggca taccgcgtcg       960
     cggatggctt cgttgttctt ctcgtcggtg ttgagtgggg taagcgaggg tctgatcgct      1020
     ggcggtcagc aagagaacgt tgtgaccacc ggacaaaccg ttgttgtgca gaaagacgcc      1080
     ttcaatgatc ggcagctggc gcttgtcgga ctcggcaaag tcggaacgaa tgcaacccag      1140
     atgttgcagc ccaccatcaa caggaagccc acggcgagta tcggccagaa aaccgagatc      1200
     ggcgtgctct ttctgagcga cgtccctgca tccgcattcg gcaaataa                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page