(data stored in ACNUC9435 zone)

EMBL: AM039951.ICMJ

AM039951.ICMJ        Location/Qualifiers
FT   CDS_pept        complement(174157..174909)
FT                   /transl_table=11
FT                   /gene="icmJ"
FT                   /locus_tag="XCVd0164"
FT                   /product="putative IcmJ-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19976"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19976.1"
FT                   /translation="MRDILLSVARASQRLIPAAGHGGRKDKEHAGSREALLGQARFLRR
FT                   CAFCDFKFGGVADECEVHHLDGDHANNTADNLTLACVLCHMPHHLDLASRRWADSPGAL
FT                   IYLPELTQAELSSLLQAIAYTIAVGSAEMKPGEVVTVAEQAGHDIYPHVVYARLTARAA
FT                   QVEGTKNGESQRHQLSSPVVMARVLQSMSDADYADRGQLLAGVRYLAPLDPIVELAKSW
FT                   LVDGSGFKNLDLASWREIAAAAGVANGG"
     atgcgggaca tcctgctctc cgtagcacgc gcctcccagc ggctgatccc agccgctggg        60
     cacggtgggc gtaaggacaa ggagcacgcg ggctccagag aggcgctgct gggccaagcg       120
     cgtttcctgc gccgctgtgc tttctgtgac ttcaagttcg gtggggtagc agacgaatgc       180
     gaagtccacc acttagacgg tgaccatgcc aacaacacag ctgacaacct gaccttggct       240
     tgtgtcctgt gccacatgcc gcaccacctg gaccttgcaa gtcggcgatg ggcggatagc       300
     ccgggagcgc tcatctatct tcctgagttg acccaagcgg aattgagctc gctgctccaa       360
     gcgatcgcct acaccattgc ggtgggatcc gcagaaatga agcctggtga agtggtgacg       420
     gtcgcagagc aagcaggtca tgacatctat ccccacgtgg tctacgcgcg gctcacagcg       480
     cgtgcggcac aggtggaggg caccaagaac ggcgaatcgc agcgccatca actgtcctca       540
     cctgtcgtga tggcgagagt tctgcagtcg atgagtgatg ccgattacgc cgaccgcggt       600
     cagctcctgg ccggtgtgcg ctacctggcg ccgctcgatc cgatcgtgga gctggccaag       660
     tcctggctag ttgacggaag cggattcaag aatctggacc tggcgagctg gcgcgagatc       720
     gctgcagctg ccggagttgc aaatgggggc taa                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page