(data stored in ACNUC9435 zone)

EMBL: AM039951.ICMK

AM039951.ICMK        Location/Qualifiers
FT   CDS_pept        complement(178096..179037)
FT                   /transl_table=11
FT                   /gene="icmK"
FT                   /locus_tag="XCVd0169"
FT                   /product="putative IcmK-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19981"
FT                   /db_xref="InterPro:IPR022073"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19981.1"
FT                   /translation="MILGRMFLASAALLASAAAMAQAPAAAAAGAAAVPLQQAPAAPPA
FT                   GTTVPAPGLPILPEVNEVAFDRVKANAAPLTPEQIRDLRRLVDDAERAASIAARGTPRP
FT                   VSTSVVANLAPGAEPAVVRLAYGAVTNVLFVDGIGNALPITSPDLMKGGFDAFPVAENS
FT                   NVLKLFPTQPYATGNISVSLKGVSAPVPLMLITGQREVDYRVDVRVIGGNIAQKLAGSG
FT                   SAGSAVTTTMLEFITGAIPQGAVALKSDSPDVQAWAYNGAYYVKTPLTLLSPAYRNPGK
FT                   SPDGTSYYEIPPTPIVVVSISGSPKHVKIEAP"
     atgatcctgg gacgcatgtt tctggcgagc gcggcattgc tggcgtcggc ggcggccatg        60
     gcgcaggcac cagctgccgc agctgcaggg gccgctgccg tacccctgca gcaagcaccg       120
     gccgcgccgc ctgccggtac cactgtgccg gcgcccggcc tgccgatcct tcccgaggtc       180
     aatgaggtcg ctttcgatcg cgtcaaagcc aacgctgcgc cgctcacacc agagcagatc       240
     cgagatctcc gtcgccttgt agacgacgcg gaacgtgccg cgtcgatagc agcgcgtggc       300
     acgcccaggc ctgtatcaac ctccgtcgtc gcaaatctgg cccccggcgc agaaccggcg       360
     gtggtgcgct tggcctatgg cgcggtaaca aatgtgctgt tcgtggacgg gatcggcaat       420
     gcgctaccga tcacgtcgcc cgatctcatg aaaggagggt tcgacgcctt cccggtggcc       480
     gagaacagca atgttctcaa gctatttccc acacagccct atgcgaccgg gaacatctcc       540
     gtctccttga aaggtgtttc ggcccccgtc ccgctgatgt tgatcacggg tcaacgggaa       600
     gtcgactacc gggtggatgt tcgggtcatc ggcgggaaca ttgcccagaa gctcgcaggt       660
     agtggaagcg ccggcagcgc tgtgaccacc acgatgctgg agtttattac cggtgccatc       720
     ccgcagggtg ctgtcgcgct gaagagcgat agccccgatg tgcaggcttg ggcctacaac       780
     ggggcctact acgtaaagac gccactgaca cttctgtcgc ccgcttaccg caatccaggc       840
     aagagtccgg acggcaccag ctactacgaa atcccaccga ccccgattgt ggtggtgtcg       900
     attagcggaa gtcccaagca cgtcaagata gaggcgccgt ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page