(data stored in ACNUC9435 zone)

EMBL: AM039951.ICML

AM039951.ICML        Location/Qualifiers
FT   CDS_pept        complement(179034..179867)
FT                   /transl_table=11
FT                   /gene="icmL"
FT                   /locus_tag="XCVd0170"
FT                   /product="putative IcmL-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19982"
FT                   /db_xref="InterPro:IPR021055"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19982.1"
FT                   /translation="MQSVSNYAVLPTAKGHIRWHISLTRLLWCRILVNDFQTVVARRMD
FT                   DSPKPPASSKAKPDAVSPLGGYPPLAIDVAKLAFYGRHFGKLVAAILILSFAQCAQVGW
FT                   NMFKERREVRREYFGVDFKTGRMVRLVPLNEPYLAKPAMLTRVQECVQGANTYDFVNFQ
FT                   QSFQSISTCFTDGGWNAFAQELERVGTLKAVRRQRLVTQAVATGVPVIIGEQQIGGVLT
FT                   YTVQMPIRVSFQGGEGGRGLATQNLLITATVQRVPEYENQYGIGISAYTAEERRQ"
     gtgcaatcgg tgtccaacta tgccgttctt cccacggcca aaggccacat tcgttggcat        60
     atatcgttga cccgcctgtt atggtgtcgt atcctcgtga acgatttcca aacagttgtg       120
     gcgcgacgaa tggacgattc tccgaaaccg cctgccagct ccaaggctaa gcctgacgca       180
     gtgagcccgc taggtggcta tccgccgctg gcaattgatg tagcaaagct ggccttctat       240
     gggcgccatt tcgggaagtt ggttgcggca atcttgattt tgtcgtttgc gcaatgtgcc       300
     caggtgggct ggaacatgtt caaagagcgc cgggaggtac ggcgcgagta ctttggcgtc       360
     gatttcaaga cgggccgtat ggtccgcctc gtgccgctga acgagccgta cctggccaaa       420
     cccgcgatgc tcactcgtgt ccaggagtgt gttcagggcg ccaacaccta cgacttcgtc       480
     aacttccagc aaagcttcca atccatctcc acctgcttta cggatggcgg ttggaacgca       540
     tttgcgcagg aactggaacg cgtcggaacc ttgaaggcgg tccgccgcca gcgccttgtg       600
     actcaagcag tcgccacggg cgtgccggtc attatcggag agcagcagat cggtggcgtc       660
     ttgacctaca ccgtgcagat gccgattcgc gtcagcttcc agggcggtga gggcggtcga       720
     ggtctggcga cacagaacct gctcattaca gccaccgtgc aacgcgtccc cgagtacgag       780
     aaccagtatg gcattggcat cagcgcgtac acggccgagg aacgccggca atga             834
//

If you have problems or comments...

PBIL Back to PBIL home page