(data stored in ACNUC9435 zone)

EMBL: AM039951.ICMO

AM039951.ICMO        Location/Qualifiers
FT   CDS_pept        47904..50471
FT                   /transl_table=11
FT                   /gene="icmO"
FT                   /locus_tag="XCVd0043"
FT                   /product="putative IcmO-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19855"
FT                   /db_xref="GOA:Q3C061"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C061"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19855.1"
FT                   /translation="MSIQGVDKRNEISRERLIRDTRPFFLRLLAGLGAPFAVAVAGLVL
FT                   CVIAVFVPALADVCLLVGLLYALIPRRGVEDVPFRVPKYSGGVDPNEIDSKTGKPKRGR
FT                   GIAFMGNRGQDDAECWGADTDVKRHWFFLGSTGAGKTEGLVSMCINAFIWVSGLLYTDG
FT                   KGDVSLYGKLFSSARIFGREDDFLLLNFMTGNADTQRKRSDKLSNNYNPFVDGNAASKT
FT                   QLLVNLMDSGGDGKGGDVWKGRAISFIATVMPALIDKRDAGSLLLHVGRIREYLPFLKL
FT                   LELLRDPDVLQDNKTRINAFLLDVPGYRADKGEQQANTFFEQYGYQQMQFTRILSSLAD
FT                   TYGHIFKTEQAEIDMRDVVVNRRILVTLLPALESSRPELGNLGKIVVAGVKGMMGSNLG
FT                   NIVEGSKRSVLDARATNAPTPFLTIFDEHGYYLTEDTALMWAQARSLGFWLISAGQDLQ
FT                   AYFRTSKEETKAILGSSNTKVIGKVEDPTETWEMIQAMGGEALISTLSDYDLDVDGVAG
FT                   GYMEGTSVKVERVKRIDLQDLQRQVEGEVHMLFGGDIIRGRIFYADPPSTSEFRLNHFI
FT                   KVLPPSTEGILSLKIDARRYIDQLHEPEIAFANQRPDDPYFSYAADLLRAPGVQKYKGN
FT                   RQGAELGVCLLTGFQTTPVINRGAVSGGGSAGGGLNAQPQPQPQPQPQPQSEEENSAVV
FT                   SASLTQRVDDGAAGEYFDAANLETTSVFAAVKPSPAVPGQPVFSAEESALYAATAVAAS
FT                   SLVDVAVAKDISSLFMDSQNGEPGPLDIEYTHAGLTALGQALGGTSAAASAAADAMIIT
FT                   AAEATSYPAPPTPPSSDVASTRMQSAMDELEALLGSSGAPNEL"
     atgagcatcc agggcgtcga caagcggaat gagatctcgc gggaacggtt gattcgcgat        60
     acgcggccgt tcttcctgcg gcttctcgct ggactgggtg cgccatttgc ggttgccgtg       120
     gccggactgg tgctctgtgt catcgccgtt ttcgtcccgg cgctggcaga cgtttgcttg       180
     ctggtgggcc ttctgtacgc gctcatccct cgccgtggag tcgaggatgt tccgttccgt       240
     gttccgaagt actctggcgg agttgatcca aacgagatcg actcgaagac gggcaagccg       300
     aaacgcgggc gcggaattgc cttcatgggc aaccgtgggc aagacgatgc cgaatgctgg       360
     ggcgccgata ccgacgtcaa acgacactgg ttctttttgg gttctaccgg cgcaggtaaa       420
     accgaaggac ttgtgtcgat gtgcatcaac gctttcatct gggtgagtgg tttgctctac       480
     acggatggga agggcgatgt aagcctgtat ggcaagctat tctcatcagc acgaatcttc       540
     ggtcgcgagg atgacttcct gctgctgaac ttcatgaccg gcaacgccga tacgcagcga       600
     aagcgctcgg acaagctgag caacaactac aacccgtttg tggacggcaa tgctgcctcc       660
     aagacacagt tgctggtcaa cctgatggat tcgggcgggg acggtaaggg cggagacgta       720
     tggaaggggc gtgcgatttc cttcatcgcg accgtcatgc cggccctgat cgacaaacga       780
     gacgcaggct cactgctcct gcatgtcggc cggatccgtg agtacctgcc gttcctgaag       840
     cttctcgaac tattgcgtga cccggacgta ttgcaagaca acaagacgcg catcaacgcg       900
     tttttgcttg acgtgcccgg ctatcgggcg gacaaaggcg agcagcaggc aaacacgttc       960
     tttgaacagt acggctatca acaaatgcag ttcacgcgca tcttgtcgtc gcttgctgac      1020
     acgtacggtc atatcttcaa gaccgagcag gccgagatcg acatgcgcga tgtggtggtt      1080
     aaccgtcgca tcctggtaac cctgctgccg gccctggaaa gctcccggcc ggagctcggc      1140
     aatctcggca aaattgtagt cgctggcgtg aagggcatga tgggctcgaa cctgggcaac      1200
     atcgtggaag gctcaaaacg gtctgttctt gacgcccgcg ctaccaatgc gcccacgccg      1260
     ttccttacca tctttgacga gcatggctac tacctgaccg aggatacggc ccttatgtgg      1320
     gctcaggcgc ggtcgctcgg gttctggctg atttcggcag gacaggacct gcaggcgtat      1380
     ttccggacgt cgaaggaaga aacgaaagcc atccttggta gctccaatac caaggtcatt      1440
     gggaaggttg aggaccccac cgagacctgg gagatgatcc aagcaatggg cggcgaagcg      1500
     ctcataagca cgctcagcga ctatgacctg gacgttgacg gggtggccgg tgggtacatg      1560
     gaaggaacgt ccgtcaaggt tgagcgtgtc aagcgcatcg acctgcagga tctccagcgg      1620
     caggtcgagg gcgaggtgca catgctcttc ggcggcgaca ttatccgcgg gcgaatcttt      1680
     tacgctgatc cgccgtccac ctctgaattc cgtctcaacc atttcatcaa ggtgcttccg      1740
     ccaagcaccg agggaatctt gtccctcaaa atcgatgcgc gcagatacat cgatcagctg      1800
     cacgaacctg aaattgcctt cgcgaaccag cgcccggatg atccctattt ttcttacgcg      1860
     gctgatttgc tgcgggcgcc aggggtacaa aaatacaagg gtaaccggca aggagcagag      1920
     ctcggggtgt gtctgcttac aggcttccag acgacgccgg tgatcaatcg aggtgctgta      1980
     tctggtggcg gcagcgccgg cggtggtctc aatgctcagc cgcagccgca gccgcagccg      2040
     cagccgcagc cgcagtccga ggaagagaac agtgcagtgg tgtcggcgag cttgactcag      2100
     cgtgtggatg atggagctgc cggtgaatat ttcgatgcag cgaacctcga aacgacatcc      2160
     gtatttgccg cggtgaagcc ttcgcctgca gtgcctggcc aacctgtctt cagtgcggaa      2220
     gagtcggctc tgtatgcggc cacggccgtc gcagcatcat cattggtcga tgtagcagta      2280
     gcgaaggaca tcagctcatt gttcatggat tctcaaaatg gagagcctgg accgttggat      2340
     atcgagtaca cgcacgccgg cctgaccgca cttggtcagg cgctcggtgg aacgtcggct      2400
     gctgcctctg cagccgctga cgcgatgatt attactgcag cggaagcgac ctcatatccg      2460
     gcgccgccca cgccacccag tagtgatgta gcgagcacta ggatgcaaag tgcgatggat      2520
     gaactcgaag cactgctcgg cagttcagga gcgccgaatg agctttga                   2568
//

If you have problems or comments...

PBIL Back to PBIL home page