(data stored in ACNUC9435 zone)

EMBL: AM039951.ICMP

AM039951.ICMP        Location/Qualifiers
FT   CDS_pept        45982..47133
FT                   /transl_table=11
FT                   /gene="icmP"
FT                   /locus_tag="XCVd0041"
FT                   /product="putative IcmP-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19853"
FT                   /db_xref="GOA:Q3C063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C063"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19853.1"
FT                   /translation="MRGRPNSEHDNGPVVVVLGLIVGIGLAWLVAHEQISWLVMWVRLL
FT                   EARVVFFDTEGLQMVYDWVASRHPRDVKIGELYSSGQVTGYYLRWVVLIVLLPMFGWMF
FT                   WRHPARSSAYRQVYSIMKLAWSQVHLYPMLKPILEMNLLTVPLDHPIHGMRALPRRYAR
FT                   RYKMLREMKDIAPDHDRSDLDVIDSKQVLVLSRCREVFAKQIGKEWAGIESLRGYERDL
FT                   LVAFAVQADGTIEDANKNTLQIIQELAIAASAAFKANDPGLIRSKRASELEARVMQSKV
FT                   VARAIRAHGYKRTVLMAMLEAGRKGGVLPAAWFRWLKPVDRVTWYCLCDMGIQPSCVES
FT                   AGARAQYLTERAAGIPVPTPMIEPAINGLREYLNEVIDVEVED"
     gtgagagggc gcccgaactc cgagcacgac aacgggccgg tggtggtcgt gctgggactg        60
     atcgttggaa ttggcctcgc atggctcgtc gctcacgagc agatctcatg gctggtgatg       120
     tgggtacgcc tgcttgaagc aagagtggtc ttcttcgaca cagagggtct gcagatggtg       180
     tacgactggg ttgccagccg gcacccacgc gacgtgaaaa tcggagagct ctacagttct       240
     ggccaagtca ccgggtatta cctgcggtgg gttgttctga ttgtgctgtt gccgatgttt       300
     ggatggatgt tctggcggca cccggcgcgt tcaagtgcgt atcgacaggt ctatagcatc       360
     atgaagctgg cgtggtcaca ggttcacctg tacccgatgc taaagccgat cctggaaatg       420
     aacttgctca cggtgccact ggaccatccc attcatggga tgcgtgcatt gccacgtcgt       480
     tacgcgcgcc gctacaagat gcttcgggag atgaaggaca ttgctcccga tcatgatcgt       540
     agcgatctcg atgtgatcga cagtaagcag gtattggtgc tctcccgttg cagggaggta       600
     ttcgcaaagc aaattggcaa ggaatgggcc ggaattgagt cgctgcgagg ctatgagcgc       660
     gacctgctag tcgcattcgc tgtgcaggcc gacggaacga tcgaggacgc taacaagaac       720
     accctgcaaa tcatccagga gctggcgatt gctgcgtcag ctgctttcaa ggcgaatgat       780
     cctggcttga ttcgatcgaa gagggcatcg gagctcgaag ctcgggtgat gcagagcaaa       840
     gtggtggcac gcgccatccg cgctcatggc tacaagcgca ctgttctgat ggccatgttg       900
     gaggccggtc gcaaaggcgg cgtgcttccc gccgcgtggt tccgttggtt gaagcccgtt       960
     gatcgtgtga cctggtactg cctgtgtgac atgggcatcc agcccagctg tgtggagtcc      1020
     gccggtgcgc gagcgcagta cctcaccgaa cgagcggctg gcatcccggt accaactccg      1080
     atgattgagc cagcaataaa tggtttgcgc gaatacttga acgaggtgat cgatgtcgaa      1140
     gtggaagatt aa                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page