(data stored in ACNUC9435 zone)

EMBL: AM039951.ICMT

AM039951.ICMT        Location/Qualifiers
FT   CDS_pept        9037..9318
FT                   /transl_table=11
FT                   /gene="icmT"
FT                   /locus_tag="XCVd0008"
FT                   /product="putative IcmT-like type IV secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19820"
FT                   /db_xref="GOA:Q3C096"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C096"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19820.1"
FT                   /translation="MMSGPADWRNTSLMAKFLVFDARACIPFVILFYSPSFAKLGVSIG
FT                   LFLFFSVLSFYKYTLVVLVRRMRCKLAGPVRSGVAWWHRPQRRLYRHR"
     gtgatgtcag gaccggcaga ttggcgcaac acgtcactga tggccaagtt cctggtcttt        60
     gacgcgcgcg catgtatccc cttcgtcatc ctgttctaca gcccgtcgtt cgccaagctg       120
     ggagtgtcca tcgggctgtt cctattcttc tcggtcttgt ccttttacaa gtacacgctc       180
     gttgtgctcg tgcggcgcat gcgctgcaag ctcgcggggc ctgtgcggtc cggcgtcgcc       240
     tggtggcatc gcccacaacg ccgcctgtat cggcatcgct ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page