(data stored in ACNUC9435 zone)

EMBL: AM039951.PARB

AM039951.PARB        Location/Qualifiers
FT   CDS_pept        complement(3543..4424)
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="XCVd0003"
FT                   /product="Chromosome partitioning protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19815"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19815.1"
FT                   /translation="MSRGNIEAAGMSCDTAQSLPRDNTMARKIRSAQLTAHRPDRVDYD
FT                   PGTPRLLQSAEGARYRLLAGPAPALPDDLVGGLVLTDAETIAAAARLGTTSPAELTVIE
FT                   KIQLAIALADDVKATALCLLLGERNHPEVWRWTALKRAAQELRGAVLSGSLTRGHARPL
FT                   LPLPSQLQAEWTRRALRGRWSVRTLTSMVAREGKAGTPATPSPAAADTKHLEDQLSQRL
FT                   GSPVRLEWPEAPGTRSLIIGYSDMETLKGVLQELARGPEGTGHLGNAMRSLRIELADAD
FT                   ELDALTGHLLSE"
     ttgtcacgtg gcaatattga agcggctgga atgtcgtgcg acactgcaca gtcattgcca        60
     cgtgacaata ctatggcccg caagattcgt tctgcccagc tcacggccca ccgcccggat       120
     cgagtggact acgaccccgg cacgccccgc cttctgcagt ccgctgaggg agcgcggtac       180
     cgcctgcttg cagggccagc gcccgcactt ccggatgatt tggtaggcgg cctcgtgctc       240
     actgatgcgg agacaattgc ggccgctgcc aggctcggaa ccacttcccc agcagagctc       300
     accgtgattg agaagatcca gctggcgatt gcgctggcgg acgatgtcaa ggcgaccgct       360
     ctctgccttc tcctgggcga gcgtaatcat cccgaggtct ggcgttggac cgcactgaag       420
     cgcgccgcgc aggagctgcg aggggccgtc ctatctggct cgcttacccg cggccacgcc       480
     aggcccctac tgcccctgcc ttcacaattg caggcagaat ggaccaggcg ggcgttgcgc       540
     ggcaggtggt cggttcgcac gctgacatct atggtggcgc gggagggcaa ggctgggaca       600
     ccagctaccc catccccggc cgcagccgat actaagcacc tagaggacca gctaagccag       660
     cgactgggat cacccgtacg actggagtgg ccagaagcgc ctggaacccg gtcgctgatt       720
     atcggctact ccgatatgga gacattgaaa ggtgtgctcc aggagctcgc ccggggccct       780
     gagggcaccg gccacctcgg caacgcgatg agaagcctgc gaatcgaact cgccgatgct       840
     gatgagctcg atgctttgac ggggcacttg ctgagcgagt aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page