(data stored in ACNUC9435 zone)

EMBL: AM039951.PE10

AM039951.PE10        Location/Qualifiers
FT   CDS_pept        10265..10798
FT                   /transl_table=11
FT                   /locus_tag="XCVd0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19822"
FT                   /db_xref="InterPro:IPR009440"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C094"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19822.1"
FT                   /translation="MAYIDYALDDANNWREGMDPTAPVVVVDVGGRTTDTATIIRGSTV
FT                   DHAASGTINVGVTHVLDHLRSLIMARFGVAGVRPSRLETFLRSGKVQLRGEWHDISAER
FT                   EQAVDLVLQQVRRELQRRVGDAADMQAVLLVGGGAALLASGLKTGYRHLVVPEDPEFAN
FT                   ARGMLKTLRGNVAA"
     atggcctata tcgattacgc tcttgatgac gccaacaatt ggcgggaagg aatggacccc        60
     accgcgccgg tagtggtggt ggatgtaggc ggccgtacca cggatacggc aacaattatt       120
     cgtgggtcga ccgttgatca cgcagcgtca gggacgatca acgtcggtgt cacgcatgtg       180
     ctcgaccatc tgcgcagcct catcatggcg aggttcggtg tcgcgggcgt tcgtccttcg       240
     cgactggaga cgttcttacg atcgggaaag gtgcaactgc gtggcgagtg gcatgacatc       300
     tctgctgaac gcgagcaagc cgtcgacctg gtactgcagc aagtccggcg cgaactgcag       360
     cggcgggtgg gcgatgctgc agacatgcag gcagtcctgc tcgtcggcgg cggcgccgcg       420
     ctgttggcca gcggcctgaa gacggggtac cggcacttgg tggtgcctga ggatcccgag       480
     ttcgccaatg cgcgaggcat gctgaaaacg ctgcgtggaa acgttgccgc atga             534
//

If you have problems or comments...

PBIL Back to PBIL home page