(data stored in ACNUC9435 zone)

EMBL: AM039951.PE101

AM039951.PE101       Location/Qualifiers
FT   CDS_pept        complement(111429..111830)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19913"
FT                   /db_xref="GOA:Q3C003"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C003"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19913.1"
FT                   /translation="MKRYMLDTNTVSHLVKSHPAVSRRVIEVPMTALCMSAITGGELMF
FT                   GLAKVPDAKRLQQAVMELLRRVDVLPWDGAVMERYGSVRADLEKQGKALGSLDMLIAAH
FT                   ALETDSVLVTNDAAFSRVVGLTVEDWTRS"
     atgaagcggt acatgcttga taccaacacc gtgagccatc tcgtcaagag ccatccggct        60
     gtctctcgac gggtcattga agtgcctatg actgcgctat gtatgtccgc aattaccggt       120
     ggggagctga tgttcggctt ggctaaggtg ccagacgcca aacgccttca gcaagccgtc       180
     atggaactcc tgcggcgcgt ggatgtgctg ccttgggatg gcgcggtaat ggagcgttac       240
     ggaagcgtaa gagcggacct agaaaagcaa ggtaaagcgc ttgggtcgct cgacatgctt       300
     atcgcagcac atgcactgga aacggattct gtcctcgtta ccaatgacgc cgcatttagt       360
     cgtgttgttg gtttgaccgt ggaagattgg acacgcagct aa                          402
//

If you have problems or comments...

PBIL Back to PBIL home page