(data stored in ACNUC9435 zone)

EMBL: AM039951.PE102

AM039951.PE102       Location/Qualifiers
FT   CDS_pept        complement(111827..112087)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0102"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19914"
FT                   /db_xref="GOA:Q3C002"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C002"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19914.1"
FT                   /translation="MSQVAKLFINGRSQAVRLPAAYRFTEKEVFIRQDPETGDVILSRK
FT                   PATWEDFFIALKSADVPANFLDAAERNQGTQDRDPFAGWRE"
     gtgagccaag ttgccaagct gttcatcaat ggccgcagcc aggcagtccg cttgcctgcc        60
     gcctatcgct ttaccgagaa agaggttttc attcgccaag acccggagac cggtgacgtc       120
     atcctgtctc ggaagcctgc aacgtgggag gacttcttta tcgcactcaa gagcgcagat       180
     gtgcctgcta attttctaga tgccgccgag cgcaatcagg gcacgcagga ccgtgatcct       240
     tttgcgggat ggcgcgaatg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page