(data stored in ACNUC9435 zone)

EMBL: AM039951.PE111

AM039951.PE111       Location/Qualifiers
FT   CDS_pept        119094..119513
FT                   /transl_table=11
FT                   /locus_tag="XCVd0111"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19923"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0C5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19923.1"
FT                   /translation="MRVVLDTNVLLAALISSHSPPDIIYRGWLAARFELVTGTAQLDEL
FT                   RRVSRYPKIKAILPAHRVGTMINNMQRAVVLHVLPPLPDRIEVNDPNDAFLLAMALASE
FT                   ADYLVTGDRRAGLLQRGSIGRTRIVTPVTFCAEAL"
     atgcgggtcg tcctcgacac caacgtattg ctggccgcgc tgatctcgtc gcacagccca        60
     cccgacatca tctatcgcgg ttggcttgca gcacgctttg aactggtgac agggacggcg       120
     cagcttgatg aactgcgccg cgtgagccgt tacccgaaga tcaaggcaat cctgcccgcg       180
     catcgcgtcg gcacgatgat caacaacatg cagcgcgccg ttgtgctgca tgtattgccg       240
     cctctgcctg atcgcatcga ggtcaatgat ccgaacgatg cgttcctgct ggcgatggca       300
     ctggccagcg aggccgatta ccttgtgact ggcgaccgcc gcgctgggct gctgcaacgc       360
     ggtagcattg gccgcacgcg catcgtcacg ccagtcacct tctgcgccga ggcgctttga       420
//

If you have problems or comments...

PBIL Back to PBIL home page