(data stored in ACNUC9435 zone)

EMBL: AM039951.PE113

AM039951.PE113       Location/Qualifiers
FT   CDS_pept        122512..123210
FT                   /transl_table=11
FT                   /locus_tag="XCVd0113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19925"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZZ1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19925.1"
FT                   /translation="MQQMTQQPLNDAQLDRLGDFLEGVGAPAMNLEMLDGFFAALICGP
FT                   ETVLPSEYLPQVFGEDHCFDSNDQAAEILGLVMRHWNTIASELFRTLEKDDVYLPVLLE
FT                   DADGAVHGNDWARGFMRGIQLRPNSWQELIGSEEFGGPMLPIMILTHEHDPDPAMRPPE
FT                   IAPDKRDELLQSLIAGLTHIYRYFASHRQLATQGPLRRQGPKIGRNDQCPCGSGRKYKH
FT                   CCATSAPTFH"
     atgcaacaaa tgacgcaaca accgttgaac gatgcccagc ttgatcggct gggcgacttt        60
     ctcgaaggag tcggcgcacc tgcaatgaat ctcgaaatgc tcgatgggtt ctttgccgca       120
     ctcatttgtg gtccagaaac ggttttgccc agcgaatact tgccacaagt attcggggaa       180
     gaccattgct tcgacagcaa tgaccaagcc gccgaaattc ttggcttggt catgcggcac       240
     tggaacacga ttgcatcaga attgttccgc actctggaga aagacgatgt ctaccttccc       300
     gtgctactcg aagatgcgga tggggccgta cacggtaacg actgggcacg tggtttcatg       360
     cgcggcattc aattacggcc caatagttgg caagagttga tcggcagcga agaatttggc       420
     gggcccatgc tgccaatcat gatcttgacc catgaacatg atcctgatcc cgccatgcgc       480
     ccgccagaga ttgcgccgga caaacgcgat gagttgcttc agtccctgat tgccggactg       540
     acgcacatct atcgctactt tgcctcacat cgccaattgg caacccaagg gcctttacgc       600
     agacaaggtc ctaagattgg gagaaatgat cagtgcccat gtggcagtgg gcggaagtac       660
     aagcattgct gtgctaccag cgctccgaca tttcattga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page