(data stored in ACNUC9435 zone)

EMBL: AM039951.PE114

AM039951.PE114       Location/Qualifiers
FT   CDS_pept        123354..124199
FT                   /transl_table=11
FT                   /locus_tag="XCVd0114"
FT                   /product="putative cointegrate resolution protein S"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0114"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19926"
FT                   /db_xref="GOA:Q3BZZ0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZZ0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19926.1"
FT                   /translation="MARYLAAYAGQLALNTLRHRLAALAQWHQAHGFADPTRAPVVRKV
FT                   LKGIQTVHPSQEKRATPLQLTQLGQVVDWLDGAATAAGTRDDAAGRLRHMRDRAFVLLG
FT                   FWRGFRGDELVRLQVQDLELVAGEGMTCFLPHSKSDRQHAGTTYKVPALSRWCPVAATM
FT                   AWVAAAALHEGPLFRAVNQWGGIAAAPLHPNSLVRLLRRIFREAGLSSPNDYSGHSLRR
FT                   GFAGWANANGWDVKALMEYVGWRDVQSAMRYIDGADPFARQRIEASLPEAPALPRPATT
FT                   "
     gtggcgcgct acttggccgc ctacgccggg caactcgcgc tcaacacact caggcaccgg        60
     ctcgcagcac tggcccagtg gcaccaggcg cacggtttcg ccgaccccac gcgggcgccc       120
     gtcgtacgca aggtgctcaa gggcatccaa acggtgcatc cgagtcagga aaagcgagcc       180
     acgccactgc agctcacgca gttaggtcag gtcgtggatt ggctcgatgg cgccgcaact       240
     gcggccggaa cgcgtgacga tgcggcaggt cggctccggc acatgcgcga tcgcgccttt       300
     gtactgctgg gcttttggcg cggcttccgc ggcgacgaac tggttcgcct ccaggttcag       360
     gatttggagt tggtggccgg cgaaggcatg acctgcttcc tgccgcacag caagagcgat       420
     cgccagcacg ccggcaccac ctacaaggtc ccggcgctgt cgcgctggtg cccggttgcc       480
     gccaccatgg cctgggtcgc ggcagccgcc ctccacgagg ggccactgtt tcgcgcggtc       540
     aaccagtggg gtgggattgc cgccgcgccg ctccacccta acagcctggt gcgcctgcta       600
     cggcggatct tccgcgaggc cgggctgagc tctcccaacg actacagcgg ccactcgctg       660
     cggcgcggct tcgccggctg ggccaacgcc aacggctggg acgtcaaggc gctgatggag       720
     tacgtcggct ggcgagacgt gcagtcggcg atgcgctaca tcgacggggc cgatccgttc       780
     gcccgccagc gcatcgaagc cagtctgccg gaagcgcctg cgctgccaag gcctgcaacg       840
     acctga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page