(data stored in ACNUC9435 zone)

EMBL: AM039951.PE116

AM039951.PE116       Location/Qualifiers
FT   CDS_pept        127474..128784
FT                   /transl_table=11
FT                   /locus_tag="XCVd0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19928"
FT                   /db_xref="GOA:Q3BZY8"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19928.1"
FT                   /translation="MGTNAAIEKTQQPPLRQATVLVPAAKMPEFTKRLEALNKKAAKFG
FT                   LDALTVELAHVTPYLQQRRVHGAGEEVTLVPWTTSAPLPADAVGLIDMHSLLLRFPLVK
FT                   LGDWHVVAQLDATPAAGALVFAVTDVADDRTEAARRRDHPMHCEHCHTARARKQIYLLR
FT                   NTNTGAYQQVGSTCLQDFTGIDPARALFLAKLADFQRYADALGDQAAAGAAGAVATLDY
FT                   LARVVFLCESSSFIPVSKARELRIDATYLQATELSDAHRRNPAAGRAFAAARERLQAEA
FT                   AAVVAWFAGREPTDAFEANVKAVLASDTIKADARHLATAAAAVPTYQRHQSAAQLLLRA
FT                   ARSAHVATEGDKLERPLRVYQVATIDSHFGPQERVSLVDDDGNCFTWRTAAAPGELLRP
FT                   SNRERRFDAGFKIKKHITSQGTAITEISHVRVKRWLP"
     atgggcacga acgccgcgat cgagaagaca caacagccgc cgttgcggca ggcgacggtg        60
     ctggtgcccg ccgccaagat gcctgaattc accaagcggc ttgaagcact caataaaaaa       120
     gcggccaagt tcgggctcga tgccctcacc gtcgaactgg cgcacgtcac gccttatctg       180
     cagcagcgcc gggtgcacgg cgcaggcgaa gaagtgacgc tggtcccgtg gaccaccagc       240
     gcgccgctgc cagccgacgc ggtgggcctg atcgacatgc acagcctgct cctgcgcttt       300
     ccactggtca agctgggcga ctggcacgtt gtcgcccagc tcgatgccac gcctgcggcc       360
     ggcgcgctgg tgtttgcggt gacggacgtg gcggacgatc gcaccgaggc ggcacgccgc       420
     cgtgaccacc ccatgcactg tgagcattgc cacacggccc gggcacgcaa gcagatctac       480
     ctgctccgca acaccaacac cggggcgtat cagcaagtgg gcagcacatg cctgcaggac       540
     ttcactggga tcgacccggc ccgggcgctc ttcctggcca agctggccga cttccagcgc       600
     tacgccgatg ccctgggcga ccaggccgcc gcaggggcgg ccggggcagt tgctaccttg       660
     gactatctgg cgcgcgtcgt gttcctgtgc gagtccagca gcttcatccc cgtcagcaaa       720
     gcacgggaac tccgcattga cgccacctac ctgcaagcga ccgagctctc cgacgcgcat       780
     cgacgcaatc cggccgctgg ccgcgccttc gccgcggcgc gggaacgtct gcaggccgag       840
     gctgccgcgg tggtcgcctg gtttgccgga cgcgagccta cggacgcgtt tgaagccaac       900
     gtcaaagcgg tgctggccag cgacaccatc aaggcagatg cccgccacct ggcgaccgcc       960
     gccgcggccg tgccgaccta ccagcggcac cagagcgcgg cgcagctgct gctgcgggca      1020
     gctcgctcgg cgcacgtggc caccgaaggc gacaagttgg agcggcccct acgtgtctac      1080
     caggtcgcga cgatcgactc acacttcggg ccgcaggaac gtgtgagcct ggtggatgac      1140
     gacggcaact gcttcacttg gcgcacggct gccgcgccag gggagctctt gaggcccagc      1200
     aaccgcgagc gccgctttga tgccggcttc aagatcaaga agcacatcac ttcccagggc      1260
     accgcaatca ccgagatctc ccacgtccgc gtcaagcgct ggctgcccta g               1311
//

If you have problems or comments...

PBIL Back to PBIL home page