(data stored in ACNUC9435 zone)

EMBL: AM039951.PE117

AM039951.PE117       Location/Qualifiers
FT   CDS_pept        129011..129280
FT                   /transl_table=11
FT                   /locus_tag="XCVd0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19929"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZY7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19929.1"
FT                   /translation="MLINGVVVDDIALDEVKDADKIVINGGVVFADENDRAGCSATSHF
FT                   NRWKKAQTTQFVSVQVSNDDVQALQELLAQFGQGRTNFKVTLGS"
     atgttgatca acggcgtcgt cgtggatgac atcgcccttg atgaggtcaa ggatgccgac        60
     aagatcgtca tcaatggagg cgtggtcttt gctgatgaga acgaccgcgc tggctgttct       120
     gcgacgtcgc acttcaacag atggaagaaa gcccaaacca cgcaattcgt cagcgtccag       180
     gtcagcaacg atgacgtgca ggcactacaa gaattgctag cgcaattcgg tcaaggccgc       240
     acgaatttca aggtcacgct cggcagctaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page